RAB9B Recombinant monoclonal antibody

• 

  WB analysis using 85394-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85394-1-RR (RAB9B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 85394-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85394-1-RR against Human RAB9B were performed. The affinity constant is 12.6 nM.

RAB9B Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 85394-1-RR

Clone No.242790A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Rab 9 like protein, Rab 9L, RAB9L, Rab-9L, Rab-9-like protein

---

Tested Applications

• Positive WB detected in: HeLa cells, Raji cells, THP-1 cells, K-562 cells, Jurkat cells, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85394-1-RR targets RAB9B in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12862

  Product name: Recombinant human RAB9B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-201 aa of BC093756

  Sequence: MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKEDRQVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC

• Full Name: RAB9B, member RAS oncogene family
• Calculated Molecular Weight: 201 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC093756
• Gene Symbol: RAB9B
• Gene ID (NCBI): 51209
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NP90
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAB9B, also named as RAB9L, is involved in the transport of proteins between the endosomes and the trans Golgi network. RAB9B belongs to the Ras-related superfamily of guanine nucleotide binding proteins, which includes the Ral/Rec, Rap, R-Ras, and Rho/Rab subfamilies