RABEP2 Monoclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 60125-1-Ig (same clone as 60125-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 60125-1-Ig (RABEP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60125-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 60125-1-Ig (same clone as 60125-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 60125-1-Ig (RABEP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60125-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 60125-1-Ig (same clone as 60125-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 60125-1-Ig (RABEP2 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60125-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 60125-1-Ig (same clone as 60125-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 60125-1-Ig (RABEP2 antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60125-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 60125-1-Ig (same clone as 60125-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 60125-1-Ig (RABEP2 antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60125-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 60125-1-Ig (same clone as 60125-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60125-1-Ig (RABEP2 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 60125-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 60125-1-Ig (same clone as 60125-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60125-1-Ig (RABEP2 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 60125-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RABEP2 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 60125-1-PBS

Clone No.1A4A4

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig

Applications

WB, IHC, Indirect ELISA

Synonyms

1A4A4, FRA, Rab GTPase-binding effector protein 2, Rabaptin-5beta, RABEP 2

---

Product Information

60125-1-PBS targets RABEP2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat, pig samples.

• Tested Reactivity: human, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6197

  Product name: Recombinant human RABEP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-299 aa of BC058900

  Sequence: MAAAAPVAADDDERRRRPGAALEDSRSQEGANGEAESGELSRLRAELAGALAEMETMKAVAEVSESTKAEAVAAVQRQCQEEVASLQAILKDSISSYEAQITALKQERQQQQQDCEEKERELGRLKQLLSRAYPLDSLEKQMEKAHEDSEKLREIVLPMEKEIEELKAKLLRAEELIQEIQRRPRHAPSLHGSTELLPLSRDPSPPLEPLEELSGDGGPAAEAFAHNCDDSASISSFSLGGGVGSSSSLPQSRQGLSPEQEETASLVSTGTLVPEGIYLPPPGYQLVPDTQWEQLQTEM

• Full Name: rabaptin, RAB GTPase binding effector protein 2
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: BC058900
• Gene Symbol: RABEP2
• Gene ID (NCBI): 79874
• RRID: AB_2284821
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9H5N1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RABEP2, also named as RABPT5B, plays a role in membrane trafficking and in homotypic early endosome fusion. It has two isoforms with MW 59-63 kDa.