RABEPK/p40 Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of Jurkat using 66622-1-Ig (same clone as 66622-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66622-1-Ig (RABEPK/p40 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66622-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 66622-1-Ig (same clone as 66622-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66622-1-Ig (RABEPK/p40 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66622-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW 264.7 using 66622-1-Ig (same clone as 66622-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 66622-1-Ig (RABEPK/p40 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66622-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66622-1-Ig (same clone as 66622-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66622-1-Ig (RABEPK/p40 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66622-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66622-1-Ig (same clone as 66622-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66622-1-Ig (RABEPK/p40 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66622-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66622-1-Ig (same clone as 66622-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66622-1-Ig (RABEPK/p40 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66622-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66622-1-Ig (same clone as 66622-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66622-1-Ig (RABEPK/p40 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66622-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 66622-1-Ig (same clone as 66622-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66622-1-Ig (RABEPK/p40 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66622-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 66622-1-Ig (same clone as 66622-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66622-1-Ig (RABEPK/p40 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66622-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 66622-1-Ig (same clone as 66622-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using RABEPK/p40 antibody (66622-1-Ig, Clone: 1E11A3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66622-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66622-1-Ig (same clone as 66622-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using RABEPK/p40 antibody (66622-1-Ig, Clone: 1E11A3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66622-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP51484-1

  Cytometric bead array sample test of MP51484-1, RABEPK Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66622-1-PBS. Detection antibody: 66622-2-PBS.

• 

  Cytometric bead array standard curve of MP51484-1

  Cytometric bead array standard curve of MP51484-1, RABEPK Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66622-1-PBS. Detection antibody: 66622-2-PBS. Standard:Ag2593. Range: 1.563-400 ng/mL.

RABEPK/p40 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66622-1-PBS

Clone No.1E11A3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

p40, RABEPK, RAB9P40, Rab9 effector protein with kelch motifs, 40 kDa Rab9 effector protein

---

Product Information

66622-1-PBS targets RABEPK/p40 as part of a matched antibody pair:

MP51484-1: 66622-1-PBS capture and 66622-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7796

  Product name: Recombinant human RABEPK protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-372 aa of BC065725

  Sequence: MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKVFIVGGANPNGSFSDVHTMDLGKHQWDLDTCKGLLPRYEHASFIPSCTPDRIWVFGGANQSGNRNCLQVLNPETRTWTTPEVTSPPPSPRTFHTSSAAIGNQLYVFGGGERGAQPVQDTKLHVFDANTLTWSQPETLGNPPSPRHGHVMVAAGTKLFIHGGLAGDRFYDDLHCIDISDMKWQKLNPTGAAPAGCAAHSAVAMGKHVYIFGGMTPAGALDTMYQYHTEEQHWTLLKFDTLLPPGRLDHSMCIIPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLCLVFGGMNTEGEIYDDCIVTVVD

• Full Name: Rab9 effector protein with kelch motifs
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC065725
• Gene Symbol: RABEPK/p40
• Gene ID (NCBI): 10244
• RRID: AB_2881982
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q7Z6M1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Rab9 GTPase is required for the transport of mannose 6-phosphate receptors from endosomes to the trans-Golgi network in living cells, and in an in vitro system that reconstitutes this process. P40 is an effector of Rab9 that interacts preferentially with the active form of Rab9. p40 does not interact with Rab7 or K-Ras; it also fails to bind Rab9 when it is bound to GDI. The protein is found in cytosol, yet a significant fraction (~30%) is associated with cellular membranes. P40 is a very potent transport factor in that the pure, recombinant protein can stimulate, significantly, an in vitro transport assay that measures transport of mannose 6-phosphate receptors from endosomes to the trans-Golgi network.