Home
Products
Primary Antibodies
RABL3 Polyclonal antibody, PBS Only (11916-1-PBS)

Filter: AllWBIPIHCIF/ICCFC (Intra)

WB analysis of human lung using 11916-1-AP (same clone as 11916-1-PBS)
human lung tissue were subjected to SDS PAGE followed by western blot with 11916-1-AP (RABL3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
WB analysis using 11916-1-AP (same clone as 11916-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 11916-1-AP (RABL3 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
WB analysis of human brain using 11916-1-AP (same clone as 11916-1-PBS)
human brain tissue were subjected to SDS PAGE followed by western blot with 11916-1-AP (RABL3 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
WB analysis of mouse brain using 11916-1-AP (same clone as 11916-1-PBS)
mouse brain tissue were subjected to SDS PAGE followed by western blot with 11916-1-AP (RABL3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
WB analysis of HUVEC using 11916-1-PBS
HUVEC cells were subjected to SDS PAGE followed by western blot with 11916-1-AP (RABL3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of HEK-293 using 11916-1-AP (same clone as 11916-1-PBS)
HEK-293 cells were subjected to SDS PAGE followed by western blot with 11916-1-AP (RABL3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
IP experiment of mouse lung using 11916-1-AP (same clone as 11916-1-PBS)
IP result of anti-RABL3 (IP:11916-1-AP, 3ug; Detection:11916-1-AP 1:300) with mouse lung tissue lysate 4000ug. This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 11916-1-AP (same clone as 11916-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11916-1-AP (RABL3 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 11916-1-AP (same clone as 11916-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11916-1-AP (RABL3 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 11916-1-AP (same clone as 11916-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11916-1-AP (RABL3 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 11916-1-AP (same clone as 11916-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11916-1-AP (RABL3 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 11916-1-AP (same clone as 11916-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer using 11916-1-AP (RABL3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 11916-1-AP (same clone as 11916-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer using 11916-1-AP (RABL3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
IHC staining of human cervical cancer using 11916-1-AP (same clone as 11916-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cervical cancer using 11916-1-AP (RABL3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
IHC staining of human cervical cancer using 11916-1-AP (same clone as 11916-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cervical cancer using 11916-1-AP (RABL3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 11916-1-AP (same clone as 11916-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney using 11916-1-AP (RABL3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 11916-1-AP (same clone as 11916-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney using 11916-1-AP (RABL3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 11916-1-AP (same clone as 11916-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney using 11916-1-AP (RABL3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 11916-1-AP (same clone as 11916-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney using 11916-1-AP (RABL3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
IF Staining of A549 using 11916-1-AP (same clone as 11916-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using RABL3 antibody (11916-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
FC experiment of HEK-293 using 11916-1-AP (same clone as 11916-1-PBS)
1X10^6 HEK-293 cells were intracellularly stained with 0.4 ug Anti-Human RABL3 (11916-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.
×
1X10^6 HEK-293 cells were intracellularly stained with 0.4 ug Anti-Human RABL3 (11916-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 11916-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

RABL3 Polyclonal antibody, PBS Only

Name: RABL3 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 11916-1-PBS

RABL3 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 11916-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

11916-1-PBS targets RABL3 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2531 Product name: Recombinant human RABL3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-236 aa of BC020832 Sequence: MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTCYIELWDVGGSVGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRDLVPTGVLVTNGDYDQEQFADNQIPLLVIGTKLDQIHETKRHEVLTTTAFLAEDFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFLREGNQIPGFPDRKRFGAGTLKSLHYD Predict reactive species
Full Name	RAB, member of RAS oncogene family-like 3
Calculated Molecular Weight	236 aa, 26 kDa
Observed Molecular Weight	26 kDa
GenBank Accession Number	BC020832
Gene Symbol	RABL3
Gene ID (NCBI)	285282
RRID	AB_2175960
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q5HYI8
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

The gene of Rabl3 is located on 3q13.3 and is composed of eight exons and seven introns. It is a member of the Rab subfamily, the largest group in the Ras superfamily of small guanosine triphosphatases (GTPases).