RAC1 Monoclonal antibody, PBS Only

• 

  WB analysis using 66122-1-Ig (same clone as 66122-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66122-1-Ig (Rac1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66122-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 66122-1-Ig (same clone as 66122-1-PBS)

  WB result of RAC1 antibody (66122-1-Ig, 1:2000) with si-control and si-RAC1 transfected NIH3T3 cells. This data was developed using the same antibody clone with 66122-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66122-1-Ig (same clone as 66122-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66122-1-Ig (Rac1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66122-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 66122-1-Ig (same clone as 66122-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 66122-1-Ig (RAC1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66122-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HL-60 using 66122-1-Ig (same clone as 66122-1-PBS)

  IP result of anti-RAC1 (IP:66122-1-Ig, 3ug; Detection:66122-1-Ig 1:700) with HL-60 cells lysate 4000ug. This data was developed using the same antibody clone with 66122-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66122-1-Ig (same clone as 66122-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66122-1-Ig (RAC1 Antibody) at dilution of 1:400 (under 10x lens). This data was developed using the same antibody clone with 66122-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66122-1-Ig (same clone as 66122-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66122-1-Ig (RAC1 Antibody) at dilution of 1:400 (under 40x lens). This data was developed using the same antibody clone with 66122-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 66122-1-Ig (same clone as 66122-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol ) fixed NIH/3T3 cells using 66122-1-Ig(Rac1 antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66122-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66122-1-Ig (same clone as 66122-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde ) fixed HeLa cells using 66122-1-Ig(Rac1 antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66122-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RAC1 Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 66122-1-PBS

Clone No.4A4B11

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

MIG5, p21 Rac1, RAC1, RAC1b, Ras like protein TC25, TC 25, TC25

---

Product Information

66122-1-PBS targets RAC1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17779

  Product name: Recombinant human RAC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-192 aa of BC004247

  Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLIPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

• Full Name: ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC004247
• Gene Symbol: RAC1
• Gene ID (NCBI): 5879
• RRID: AB_2881521
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P63000
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RAC1b, also named as TC25, belongs to the small GTPase superfamily and Rho family. RAC1 is a plasma membrane-associated small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, it binds to a variety of effector proteins to regulate cellular responses such as secretory processes, phagocytosis of apoptotic cells, epithelial cell polarization and growth-factor induced formation of membrane ruffles.