RACGAP1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• RACGAP1 Monoclonal antibody (66056-1-Ig)

• Featured Product
• KD/KO Validated

RACGAP1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66056-1-Ig Copied!

Clone No. 6E10A2

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

6E10A2, CYK4, GAP, Gap1, HsCYK 4

• 

  WB analysis of HEK-293 using 66056-1-Ig

  HEK-293, Jurkat, ROS1728, PC-12, Raw264.7, NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66056-1-Ig (RACGAP1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK293 cells using 66056-1-Ig

  WB result of RACGAP1 antibody (66056-1-Ig, 1:3000) with si-control and si-RACGAP1 transfected HEK293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 66056-1-Ig

  human brain tissue were subjected to SDS PAGE followed by western blot with 66056-1-Ig (RACGAP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 66056-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 66056-1-Ig (RACGAP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 66056-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66056-1-Ig (RACGAP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66056-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66056-1-Ig (RACGAP1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66056-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66056-1-Ig (RACGAP1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66056-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66056-1-Ig (RACGAP1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 66056-1-Ig

  Immunofluorescent analysis of HeLa cells, using RACGAP1 antibody 66056-1-lg at 1:50 dilution and Rhodamine-labeled goat anti-mouse IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RACGAP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HEK293 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Hela cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66056-1-Ig targets RACGAP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6944

  Product name: Recombinant human RACGAP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 334-632 aa of BC032754

  Sequence: PCIPTLIGTPVKIGEGMLADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICSLLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHLQRVAQSPHTKMDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWSQFMMVEQENIDPLHVIENSNAFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPMLK

• Full Name: Rac GTPase activating protein 1
• Calculated Molecular Weight: 632 aa, 71 kDa
• Observed Molecular Weight: 71 kDa
• GenBank Accession Number: BC032754
• Gene Symbol: RACGAP1
• Gene ID (NCBI): 29127
• RRID: AB_11043178
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9H0H5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rac GTPase-activating protein 1 (RACGAP1), localized in the mitotic spindle, has guanosine triphosphatase-activating protein (GAP) activity for the Rho family GTPases. RACGAP1 has an important influence on the initiation of cytokinesis, control of cell growth and differentiation, regulation of spermatogenesis, and tumor metastasis.

Publications

What published studies show

The RACGAP1 Monoclonal antibody (6E10A2), catalog number 66056-1-Ig, has 1 total citation. It was cited in the journal Endocrine (2024), in a study investigating how targeting RACGAP1 suppresses growth hormone pituitary adenoma growth. The research field is endocrinology, specifically pituitary tumor biology. The antibody was used in Western blot (WB) with rat species and RNAi validation.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Endocrine; Targeting RACGAP1 suppresses growth hormone pituitary adenoma growth; Authors - Feifan Sun ; KD Validated