RAD18 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RAD18 Polyclonal antibody, PBS Only (18333-1-PBS)

• 

  WB analysis using 18333-1-AP (same clone as 18333-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18333-1-AP (RAD18 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18333-1-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 18333-1-AP (same clone as 18333-1-PBS)

  IP result of anti-RAD18 (IP:18333-1-AP, 3ug; Detection:18333-1-AP 1:300) with K-562 cells lysate 2000ug. This data was developed using the same antibody clone with 18333-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 18333-1-AP (same clone as 18333-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 18333-1-AP (RAD18 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18333-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 18333-1-AP (same clone as 18333-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 18333-1-AP (RAD18 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18333-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 18333-1-AP (same clone as 18333-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using RAD18 antibody (18333-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 18333-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RAD18 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 18333-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

E3 ubiquitin-protein ligase RAD18, EC:2.3.2.27, hHR18, hRAD18, RING finger protein 73

---

Product Information

18333-1-PBS targets RAD18 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12944

  Product name: Recombinant human RAD18 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-495 aa of BC001302

  Sequence: MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVQEIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRAAESAEIEPRNKRNRN

• Full Name: RAD18 homolog (S. cerevisiae)
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 75 kDa, 85 kDa
• GenBank Accession Number: BC001302
• Gene Symbol: RAD18
• Gene ID (NCBI): 56852
• RRID: AB_2176586
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NS91
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RAD18(E3 ubiquitin-protein ligase RAD18) is lalso named as RNF73, hHR18 and belongs to the RAD18 family. It is involved in postreplication repair of UV-damaged DNA. RAD18 protein is detected in human cells as two major bands at 75 and 85 kDa by Western blot. The bands are identified as nonubiquitinated and monoubiquitinated forms of Rad18, respectively(PMID: 15509568). Monoubiquitinated RAD18 is detected mainly in the cytoplasm, whereas nonubiquitinated RAD18 is detected predominantly in the nuclei(PMID:15509568). This antibody is specific to RAD18.