• Featured Product
  • KD/KO Validated

RAD21 Recombinant monoclonal antibody

RAD21 Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA
Cat No. 84920-4-RR
Clone No.242172E3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), ELISA

242172E3, 64-kDa C-terminal product, Double-strand-break repair protein rad21 homolog, FLJ25655, FLJ40596

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84920-4-RR targets RAD21 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25481

Product name: Recombinant human RAD21 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 147-349 aa of BC050381

Sequence: EEVGNISILQENDFGDFGMDDREIMREGSAFEDDDMLVSTTTSNLLLESEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGGIFDDPPALSEAGVMLPEQPAHDDMDEDDNVSMGGPDSPDSVDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVT

Predict reactive species
Full Name RAD21 homolog (S. pombe)
Calculated Molecular Weight 631 aa, 72 kDa
Observed Molecular Weight 140 kDa
GenBank Accession NumberBC050381
Gene Symbol RAD21
Gene ID (NCBI) 5885
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDO60216
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAD21, also named as Nuclear matrix protein 1, is a 631 amino acid protein, which belongs to the rad21 family. The calculated molecular weight of RAD21 is 72 kDa, but the phosphorylated RAD21 is about 120 kDa. The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad21, a gene involved in the repair of DNA double-strand breaks, as well as in chromatid cohesion during mitosis. This protein is a nuclear phospho-protein, which becomes hyperphosphorylated in cell cycle M phase. The highly regulated association of this protein with mitotic chromatin specifically at the centromere region suggests its role in sister chromatid cohesion in mitotic cells.

Protocols

Product Specific Protocols
FC protocol for RAD21 antibody 84920-4-RRDownload protocol
IF protocol for RAD21 antibody 84920-4-RRDownload protocol
WB protocol for RAD21 antibody 84920-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...