RAD50 Polyclonal antibody

• 

  WB analysis using 29390-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29390-1-AP (RAD50 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 29390-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 29390-1-AP (RAD50 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 29390-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 29390-1-AP (RAD50 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 29390-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29390-1-AP (RAD50 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 29390-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29390-1-AP (RAD50 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 29390-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 29390-1-AP (RAD50 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 29390-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 29390-1-AP (RAD50 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse testis using 29390-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using RAD50 antibody (29390-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 29390-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using RAD50 antibody (29390-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of MCF-7 using 29390-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using RAD50 antibody (29390-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

RAD50 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 29390-1-AP

Publications(4)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

hRad50, RAD50 homolog (S. cerevisiae)

---

Tested Applications

• Positive WB detected in: C6 cells, Jurkat cells, K-562 cells, MCF-7 cells, MOLT-4 cells
• Positive IHC detected in: human breast cancer tissue, mouse testis tissue, human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse testis tissue
• Positive IF/ICC detected in: MCF-7 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 1 publications below

Product Information

29390-1-AP targets RAD50 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29949

  Product name: Recombinant human RAD50 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 275-425 aa of NM_005732

  Sequence: LDSRKKQMEKDNSELEEKMEKVFQGTDEQLNDLYHNHQRTVREKERKLVDCHRELEKLNKESRLLNQEKSELLVEQGRLQLQADRHQEHIRARDSLIQSLATQLELDGFERGPFSERQIKNFHKLVRERQEGEAKTANQLMNDFAEKETLK

• Full Name: RAD50 homolog (S. cerevisiae)
• Calculated Molecular Weight: 154 kDa
• Observed Molecular Weight: 154 kDa
• GenBank Accession Number: NM_005732
• Gene Symbol: RAD50
• Gene ID (NCBI): 10111
• RRID: AB_2918289
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92878
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAD50 belongs to the ABC-ATPase protein family that concurs in forming the Nucleotide Binding Domain (NBD). ATP binding to Rad50 induces a conformational change that dramatically increases the Rad50 NBD affinity for itself, allowing for its dimerization (PMID: 37569756). The Mre11-Rad50 (MR) complex has key functions in the detection, signaling and repair of DNA breaks (PMID: 35501303).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Transl Med; Modulation of SRC by SNTB1 activates the Hippo-YAP pathway during colon adenocarcinoma metastasis; Authors - Zhengyan Chang
mouse	WB	Ecotoxicol Environ Saf; Adolescent cetylpyridinium chloride exposure impairs homologous recombination repair and induces granulosa cell apoptosis and follicular atresia via FOXM1/CREBBP complex suppression; Authors - LiYao Ma
human	IF	Cell Genom; NRDE2 deficiency impairs homologous recombination repair and sensitizes hepatocellular carcinoma to PARP inhibitors; Authors - Yahui Wang
human	WB	CNS Neurosci Ther; Deep-targeted gene sequencing reveals ARID1A mutation as an important driver of glioblastoma; Authors - Menglin Xiao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Veronica (Verified Customer) (11-14-2022)

The antibody seems to work correctly. However, further tests need to be done.

• Applications: Immunofluorescence
• Cell Tissue Type: hTERT RPE-1