CoraLite® Plus 488-conjugated RAD50 Polyclonal antibody

• 

  FC experiment of HeLa using CL488-29390

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human RAD50 (CL488-29390) (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

RAD50 Polyclonal Antibody for FC (Intra)

Cat No. CL488-29390

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

Synonyms

hRad50, RAD50 homolog (S. cerevisiae)

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-29390 targets RAD50 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29949

  Product name: Recombinant human RAD50 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 275-425 aa of NM_005732

  Sequence: LDSRKKQMEKDNSELEEKMEKVFQGTDEQLNDLYHNHQRTVREKERKLVDCHRELEKLNKESRLLNQEKSELLVEQGRLQLQADRHQEHIRARDSLIQSLATQLELDGFERGPFSERQIKNFHKLVRERQEGEAKTANQLMNDFAEKETLK

• Full Name: RAD50 homolog (S. cerevisiae)
• Calculated Molecular Weight: 154 kDa
• Observed Molecular Weight: 154 kDa
• GenBank Accession Number: NM_005732
• Gene Symbol: RAD50
• Gene ID (NCBI): 10111
• RRID: AB_3084124
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92878
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.