Filter: AllWBIHCAffinity

WB analysis using 84969-4-RR
Various lysates were subjected to SDS PAGE followed by western blot with 84969-4-RR (RAD50 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
WB analysis of MCF-7 using 84969-4-RR
WB result of RAD50 antibody (84969-4-RR; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RAD50 transfected MCF-7 cells.
IHC staining of human placenta using 84969-4-RR
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human placenta using 84969-4-RR
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human stomach cancer using 84969-4-RR
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse stomach using 84969-4-RR
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human stomach cancer using 84969-4-RR
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse brain using 84969-4-RR
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse brain using 84969-4-RR
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse lung using 84969-4-RR
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse lung using 84969-4-RR
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat brain using 84969-4-RR
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat brain using 84969-4-RR
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat lung using 84969-4-RR
Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat lung using 84969-4-RR
Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat stomach using 84969-4-RR
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat stomach using 84969-4-RR
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse stomach using 84969-4-RR
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
Affinity and Kinetic Characterization of 84969-4-RR
Biolayer interferometry (BLl) kinetic assays of 84969-4-RR against Human RAD50 were performed. The affinity constant is 6.79 nM.

Featured Product
KD/KO Validated

RAD50 Recombinant monoclonal antibody

Name: RAD50 Recombinant monoclonal antibody
Brand: Proteintech
SKU: 84969-4-RR

RAD50 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 84969-4-RR

Clone No.242541A5

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

242541A5, hRad50, RAD50 homolog (S. cerevisiae)

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	K-562 cells, MCF-7 cells, Jurkat cells, MOLT-4 cells, C6 cells
Positive IHC detected in	human placenta tissue, human stomach cancer tissue, mouse brain tissue, mouse lung tissue, mouse stomach tissue, rat brain tissue, rat lung tissue, rat stomach tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunohistochemistry (IHC)	IHC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84969-4-RR targets RAD50 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag29949 Product name: Recombinant human RAD50 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 275-425 aa of NM_005732 Sequence: LDSRKKQMEKDNSELEEKMEKVFQGTDEQLNDLYHNHQRTVREKERKLVDCHRELEKLNKESRLLNQEKSELLVEQGRLQLQADRHQEHIRARDSLIQSLATQLELDGFERGPFSERQIKNFHKLVRERQEGEAKTANQLMNDFAEKETLK Predict reactive species
Full Name	RAD50 homolog (S. cerevisiae)
Calculated Molecular Weight	154 kDa
Observed Molecular Weight	154 kDa
GenBank Accession Number	NM_005732
Gene Symbol	RAD50
Gene ID (NCBI)	10111
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q92878
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAD50 belongs to the ABC-ATPase protein family that concurs in forming the Nucleotide Binding Domain (NBD). ATP binding to Rad50 induces a conformational change that dramatically increases the Rad50 NBD affinity for itself, allowing for its dimerization (PMID: 37569756). The Mre11-Rad50 (MR) complex has key functions in the detection, signaling and repair of DNA breaks (PMID: 35501303).