RAD50 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84969-4-RR (same clone as 84969-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84969-4-RR (RAD50 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84969-4-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 84969-4-RR (same clone as 84969-4-PBS)

  WB result of RAD50 antibody (84969-4-RR; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RAD50 transfected MCF-7 cells. This data was developed using the same antibody clone with 84969-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 84969-4-RR (same clone as 84969-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84969-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 84969-4-RR (same clone as 84969-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84969-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 84969-4-RR (same clone as 84969-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84969-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 84969-4-RR (same clone as 84969-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84969-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 84969-4-RR (same clone as 84969-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84969-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 84969-4-RR (same clone as 84969-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84969-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 84969-4-RR (same clone as 84969-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84969-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 84969-4-RR (same clone as 84969-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84969-4-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 84969-4-RR (same clone as 84969-4-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84969-4-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 84969-4-RR (same clone as 84969-4-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84969-4-PBS in a different storage buffer formulation.

• 

  IHC staining of rat lung using 84969-4-RR (same clone as 84969-4-PBS)

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84969-4-PBS in a different storage buffer formulation.

• 

  IHC staining of rat lung using 84969-4-RR (same clone as 84969-4-PBS)

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84969-4-PBS in a different storage buffer formulation.

• 

  IHC staining of rat stomach using 84969-4-RR (same clone as 84969-4-PBS)

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84969-4-PBS in a different storage buffer formulation.

• 

  IHC staining of rat stomach using 84969-4-RR (same clone as 84969-4-PBS)

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84969-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 84969-4-RR (same clone as 84969-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84969-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 84969-4-RR (same clone as 84969-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 84969-4-RR (RAD50 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84969-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84969-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84969-4-RR against Human RAD50 were performed. The affinity constant is 6.79 nM.

• Featured Product
• KD/KO Validated

RAD50 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84969-4-PBS

Clone No.242541A5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

242541A5, hRad50, RAD50 homolog (S. cerevisiae)

---

Product Information

84969-4-PBS targets RAD50 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29949

  Product name: Recombinant human RAD50 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 275-425 aa of NM_005732

  Sequence: LDSRKKQMEKDNSELEEKMEKVFQGTDEQLNDLYHNHQRTVREKERKLVDCHRELEKLNKESRLLNQEKSELLVEQGRLQLQADRHQEHIRARDSLIQSLATQLELDGFERGPFSERQIKNFHKLVRERQEGEAKTANQLMNDFAEKETLK

• Full Name: RAD50 homolog (S. cerevisiae)
• Calculated Molecular Weight: 154 kDa
• Observed Molecular Weight: 154 kDa
• GenBank Accession Number: NM_005732
• Gene Symbol: RAD50
• Gene ID (NCBI): 10111
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92878
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RAD50 belongs to the ABC-ATPase protein family that concurs in forming the Nucleotide Binding Domain (NBD). ATP binding to Rad50 induces a conformational change that dramatically increases the Rad50 NBD affinity for itself, allowing for its dimerization (PMID: 37569756). The Mre11-Rad50 (MR) complex has key functions in the detection, signaling and repair of DNA breaks (PMID: 35501303).