RAD51L1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RAD51L1 Polyclonal antibody, PBS Only (13555-1-PBS)

• 

  WB analysis of HeLa using 13555-1-AP (same clone as 13555-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 13555-1-AP (RAD51L1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13555-1-PBS in a different storage buffer formulation.

RAD51L1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13555-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

13555-1-PBS targets RAD51L1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4412

  Product name: Recombinant human RAD51L1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-384 aa of BC030219

  Sequence: MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF

• Full Name: RAD51-like 1 (S. cerevisiae)
• Calculated Molecular Weight: 384 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC030219
• Gene Symbol: RAD51L1
• Gene ID (NCBI): 5890
• RRID: AB_10597851
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15315
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.