CoraLite® Plus 488-conjugated RAGE Recombinant monoclonal antibody

• 

  IF Staining of mouse lung using CL488-83742-5

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using CoraLite® Plus 488 RAGE antibody (CL488-83742-5, Clone: 240774F11 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RAGE Uni-rAb^® Recombinant Antibody for IF-P

Cat No. CL488-83742-5

Clone No.240774F11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Synonyms

Ager, Advanced glycosylation end product-specific receptor, MOK, RAGE 1, RAGE1

---

Tested Applications

• Positive IF-P detected in: mouse lung tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83742-5 targets RAGE in IF-P applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0873

  Product name: Recombinant mouse RAGE protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 23-340 aa of NM_007425.3

  Sequence: GQNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLNTAPIQLRVREPGPPEGIQLLVEPEGGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLPEVGHEDEGTYSCVATHPSHGPQESPPVSIRVTETGDEGPAEGSVGESGLGTLA

• Full Name: advanced glycosylation end product-specific receptor
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 42-55 kDa
• GenBank Accession Number: NM_007425.3
• Gene Symbol: Ager
• Gene ID (NCBI): 11596
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q62151-1
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The receptor for advanced glycation end products (RAGE) is a cell surface transmembrane multiligand receptor, also known as Ager, is a multiligand member of the immunoglobulin superfamily. It has many isoforms and is predominantly expressed in the lung. AGER expression is upregulated in many diseases such as Alzheimer's disease, diabetes mellitus, atherosclerosis, and rheumatoid arthritis (PMID: 35099614).