Tested Applications
| Positive WB detected in | mouse brain tissue, human brain tissue, rat brain tissue, fetal human brain tissue, MCF-7 cells, HeLa cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13629-1-AP targets RALA in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4547 Product name: Recombinant human RALA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-206 aa of BC039858 Sequence: MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL Predict reactive species |
| Full Name | v-ral simian leukemia viral oncogene homolog A (ras related) |
| Calculated Molecular Weight | 206 aa, 24 kDa |
| Observed Molecular Weight | 24 kDa |
| GenBank Accession Number | BC039858 |
| Gene Symbol | RALA |
| Gene ID (NCBI) | 5898 |
| RRID | AB_2269251 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P11233 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RALA belongs to the small GTPase superfamily. Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. RALA plays a role in the early stages of cytokinesis and is required to tether the exocyst to the cytokinetic furrow. The RALA-exocyst complex regulates integrin-dependent membrane raft exocytosis and growth signaling. As an effector of the proto-oncogene Ras, it play an important role in the molecular pathology of human malignancies.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RALA antibody 13629-1-AP | Download protocol |
| WB protocol for RALA antibody 13629-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RALA Polyclonal antibody (Cat# 13629-1-AP) has 12 citations spanning journals including Cell Metabolism, Cancer Research, Nature Communications, Journal of Biological Chemistry, Journal of Extracellular Vesicles, Life Science Alliance, International Journal of Molecular Sciences, Frontiers in Chemistry, Human Pathology, Oncotarget, Journal of Clinical Investigation, and Intractable Rare Diseases Research. Research fields cover lipid homeostasis, bladder and pancreatic cancer, RalGAP tumor suppressor biology, hepatocellular carcinoma, cancer sarcopenia, renal neoplasm, proteomics, and ALS.
| Species | Application | Title |
|---|---|---|
Cell Metab Receptor-Mediated ER Export of Lipoproteins Controls Lipid Homeostasis in Mice and Humans. | ||
Cancer Res A Genome-Wide Synthetic Lethal Screen Identifies Spermidine Synthase as a Target to Enhance Erdafitinib Efficacy in FGFR-Mutant Bladder Cancer | ||
J Extracell Vesicles A multi-omics approach identifies pancreatic cancer cell extracellular vesicles as mediators of the unfolded protein response in normal pancreatic epithelial cells. | ||
Front Chem Design, Synthesis, and Biological Evaluation of Pyrano[2,3-c]-pyrazole-Based RalA Inhibitors Against Hepatocellular Carcinoma. |
Reviews
What customers say
The single review rates this antibody 5 stars for Western Blot on HEK293T cells. The user reports it works very well at a 1:1000 dilution in 3% BSA/TBST with overnight incubation at 4°C, producing a clean band at the expected 25 kDa. Overall, the feedback is positive, highlighting reliable performance and correct molecular weight for WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Rebecca (Verified Customer) (06-13-2025) | This antibody works very well for western blot (diluted 1 in 1000, 3% BSA in TBST, overnight incubation at 4 deg. C). Runs at 25 kDa.
 |
