RALA Monoclonal antibody, PBS Only

• 

  WB analysis using 67093-1-Ig (same clone as 67093-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67093-1-Ig (RALA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67093-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67093-1-Ig (same clone as 67093-1-PBS)

  WB result of RALA antibody (67093-1-Ig; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-RALA transfected HeLa cells. This data was developed using the same antibody clone with 67093-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67093-1-Ig (same clone as 67093-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67093-1-Ig (RALA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67093-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67093-1-Ig (same clone as 67093-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67093-1-Ig (RALA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67093-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67093-1-Ig (same clone as 67093-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67093-1-Ig (RALA antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67093-1-PBS in a different storage buffer formulation.

• 

  FC experiment of MCF-7 using 67093-1-Ig (same clone as 67093-1-PBS)

  1X10^6 MCF-7 cells were intracellularly stained with 0.4 ug Anti-Human RALA (67093-1-Ig, Clone:1H9H5) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (C1.18.4) (65208-1-Ig, Clone: C1.18.4) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 67093-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RALA Monoclonal Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 67093-1-PBS

Clone No.1H9H5

Host / Isotype

Mouse / IgG2a

Reactivity

human, pig

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

1H9H5, EC:3.6.5.2, RAL, Ras related protein Ral A, Ras-related protein Ral-A

---

Product Information

67093-1-PBS targets RALA in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5329

  Product name: Recombinant human RALA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-206 aa of BC039858

  Sequence: MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL

• Full Name: v-ral simian leukemia viral oncogene homolog A (ras related)
• Calculated Molecular Weight: 206 aa, 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC039858
• Gene Symbol: RALA
• Gene ID (NCBI): 5898
• RRID: AB_2882398
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P11233
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.