RAMP1 Polyclonal antibody

RAMP1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 10327-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Calcitonin-receptor-like receptor activity-modifying protein 1, CRLR activity-modifying protein 1, Receptor activity-modifying protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, human heart tissue, mouse stomach tissue, rat heart tissue
Positive IHC detected inhuman small intestine tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10327-1-AP targets RAMP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0402

Product name: Recombinant human RAMP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-148 aa of BC000548

Sequence: MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV

Predict reactive species
Full Name receptor (G protein-coupled) activity modifying protein 1
Calculated Molecular Weight 17 kDa
Observed Molecular Weight 14 kDa, 33-35 kDa
GenBank Accession NumberBC000548
Gene Symbol RAMP1
Gene ID (NCBI) 10267
RRIDAB_2269270
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO60894
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAMP1 (receptor-activity-modifying protein) is a member of the RAMP family of single-transmembrane-domain proteins which consist of an N-terminal extracellular domain, a transmembrane region, and a short intracellular C-terminal tail. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a G protein-coupled receptor, can function as either a calcitonin gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. RAMP1 transports the CRLR to the plasma membrane and then remains associated with it to function as a terminally glycosylated CGRP receptor, while RAMP2 and RAMP3 transfer the CRLR to the cell surface to generate receptors that are preferentially selective for adrenomedullin. RAMP1 can form a homodimer which migrates at 30-37 kDa on SDS-PAGE. (PMID: 9620797; 16188935; 12051717;PMID: 18384073)

Protocols

Product Specific Protocols
IHC protocol for RAMP1 antibody 10327-1-APDownload protocol
WB protocol for RAMP1 antibody 10327-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF

Int J Mol Sci

The Role of TRPV1/CGRP Pathway Activated by Prevotella melaninogenica in Pathogenesis of Oral Lichen Planus

Authors - Pan Xu
human

J Virol

CGRP inhibits SARS-CoV-2 infection of bronchial epithelial cells, and its pulmonary levels correlate with viral clearance in critical COVID-19 patients

Authors - Caio César Barbosa Bomfim
ratIF

J Headache Pain

Calcitonin gene-related peptide receptor antagonist BIBN4096BS regulates synaptic transmission in the vestibular nucleus and improves vestibular function via PKC/ERK/CREB pathway in an experimental chronic migraine rat model.

Authors - Ruimin Tian
ratWB,IHC

Front Pharmacol

Effect of Xiongmatang Extract on Behavioral and TRPV1-CGRP/CGRP-R Pathway in Rats With Migraine.

Authors - Dingding Liu
ratIF

Neurosci Lett

Calcitonin gene-related peptide differentially regulates gene and protein expression in trigeminal glia cells: findings from array analysis.

Authors - Vause Carrie V CV
ratIHC,IF

PLoS One

Suppression of mechanical hypersensitivity and change in the expression of the dopamine D2 receptor by administration of anti-CGRP antibody into the trigeminal ganglion in trigeminal neuropathic pain model rats

Authors - Hiroharu Maegawa
Loading...
||
New chat Able
正在加载,请稍候...