RAMP3 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RAMP3 Recombinant monoclonal antibody, PBS Only (87744-1-PBS)

• 

  WB analysis using 87744-1-RR (same clone as 87744-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87744-1-RR (RAMP3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87744-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HUVEC using 87744-1-RR (same clone as 87744-1-PBS)

  WB result of RAMP3 antibody (87744-1-RR; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RAMP3 transfected HUVEC cells. This data was developed using the same antibody clone with 87744-1-PBS in a different storage buffer formulation.

RAMP3 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87744-1-PBS

Clone No.253174D12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Calcitonin-receptor-like receptor activity-modifying protein 3, CRLR activity-modifying protein 3, Receptor activity-modifying protein 3

---

Product Information

87744-1-PBS targets RAMP3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5467

  Product name: Recombinant human RAMP3 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 24-118 aa of NM_005856.3

  Sequence: RAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEV

• Full Name: receptor (G protein-coupled) activity modifying protein 3
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: NM_005856.3
• Gene Symbol: RAMP3
• Gene ID (NCBI): 10268
• RRID: AB_3745728
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60896
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The receptor activity-modifying proteins (RAMPs) and the calcitonin receptor-like receptor (CRLR) are both required to generate adrenomedullin (AM) and calcitonin gene-related peptide (CGRP) receptors. During the process, RAMP3 transports the glycosylated CGRPR to the cell surface. The formation of CRLR-RAMP heterodimer is essential for the proper cell surface targeting and pharmacological characteristics of both CGRP and AM receptors. RAMP3 exists in different molecular weight forms: 19 kDa monomer, 35-40 kDa monomer heteroglycosylation, 50 kDa homodimer, and 73 kDa heterodimer (PMID: 19546305).