RAMP3 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RAMP3 Recombinant monoclonal antibody (87744-1-RR)

• 

  WB analysis using 87744-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87744-1-RR (RAMP3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HUVEC using 87744-1-RR

  WB result of RAMP3 antibody (87744-1-RR; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RAMP3 transfected HUVEC cells.

• KD/KO Validated

RAMP3 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87744-1-RR

Clone No.253174D12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Calcitonin-receptor-like receptor activity-modifying protein 3, CRLR activity-modifying protein 3, Receptor activity-modifying protein 3

---

Tested Applications

• Positive WB detected in: T-47D cells, HUVEC cells, LNCaP cells, PC-3 cells, A549 cells, Neuro-2a cells, PC-12 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87744-1-RR targets RAMP3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5467

  Product name: Recombinant human RAMP3 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 24-118 aa of NM_005856.3

  Sequence: RAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEV

• Full Name: receptor (G protein-coupled) activity modifying protein 3
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: NM_005856.3
• Gene Symbol: RAMP3
• Gene ID (NCBI): 10268
• RRID: AB_3745728
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60896
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The receptor activity-modifying proteins (RAMPs) and the calcitonin receptor-like receptor (CRLR) are both required to generate adrenomedullin (AM) and calcitonin gene-related peptide (CGRP) receptors. During the process, RAMP3 transports the glycosylated CGRPR to the cell surface. The formation of CRLR-RAMP heterodimer is essential for the proper cell surface targeting and pharmacological characteristics of both CGRP and AM receptors. RAMP3 exists in different molecular weight forms: 19 kDa monomer, 35-40 kDa monomer heteroglycosylation, 50 kDa homodimer, and 73 kDa heterodimer (PMID: 19546305).