Tested Applications
| Positive WB detected in | T-47D cells, HUVEC cells, LNCaP cells, PC-3 cells, A549 cells, Neuro-2a cells, PC-12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
87744-1-RR targets RAMP3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg5467 Product name: Recombinant human RAMP3 protein Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 24-118 aa of NM_005856.3 Sequence: RAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEV Predict reactive species |
| Full Name | receptor (G protein-coupled) activity modifying protein 3 |
| Calculated Molecular Weight | 17 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | NM_005856.3 |
| Gene Symbol | RAMP3 |
| Gene ID (NCBI) | 10268 |
| RRID | AB_3745728 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O60896 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The receptor activity-modifying proteins (RAMPs) and the calcitonin receptor-like receptor (CRLR) are both required to generate adrenomedullin (AM) and calcitonin gene-related peptide (CGRP) receptors. During the process, RAMP3 transports the glycosylated CGRPR to the cell surface. The formation of CRLR-RAMP heterodimer is essential for the proper cell surface targeting and pharmacological characteristics of both CGRP and AM receptors. RAMP3 exists in different molecular weight forms: 19 kDa monomer, 35-40 kDa monomer heteroglycosylation, 50 kDa homodimer, and 73 kDa heterodimer (PMID: 19546305).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for RAMP3 antibody 87744-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



