RAP1B Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RAP1B Recombinant monoclonal antibody, PBS Only (88443-1-PBS)

RAP1B Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 88443-1-PBS

Clone No.261087A12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

EC:3.6.5.2, GTP binding protein smg p21B, GTP-binding protein smg p21B, K REV, RAL1B

• 

  WB analysis using 88443-1-RR (same clone as 88443-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88443-1-RR (RAP1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88443-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 88443-1-RR (same clone as 88443-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using RAP1B antibody (88443-1-RR, Clone: 261087A12 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 88443-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88443-1-PBS targets RAP1B in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, monkey samples.

• Tested Reactivity: human, mouse, rat, monkey
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1282

  Product name: Recombinant human RAP1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-184 aa of BC000176

  Sequence: MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL

• Full Name: RAP1B, member of RAS oncogene family
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC000176
• Gene Symbol: RAP1B
• Gene ID (NCBI): 5908
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P61224
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RAP1B is a member of the RAS-like small GTP-binding protein superfamily. Members of this family regulate multiple cellular processes including cell adhesion and growth and differentiation. RAP1B localizes to cellular membranes and has been shown to regulate integrin-mediated cell signaling. It also plays a role in regulating outside-in signaling in platelets.