RAP2A Monoclonal antibody, PBS Only

RAP2A Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 68368-1-PBS
Clone No.1F6F3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IF/ICC, Indirect ELISA

RbBP 30, Ras-related protein Rap-2a, Ras related protein Rap 2a, RAP2, EC:3.6.5.2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68368-1-PBS targets RAP2A in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4979

Product name: Recombinant human RAP2A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-183 aa of BC041333

Sequence: MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ

Predict reactive species
Full Name RAP2A, member of RAS oncogene family
Calculated Molecular Weight 183 aa, 21 kDa
Observed Molecular Weight 21 kDa
GenBank Accession NumberBC041333
Gene Symbol RAP2A
Gene ID (NCBI) 5911
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP10114
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Ras-related protein Rap-2a (RAP2A) is also named as RbBP-30, and belongs to the small GTPase superfamily and Ras family. RAP2A is small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. In its active form, RAP2A can interact with and regulates several effectors including MAP4K4, MINK1 and TNIK. a Nedd4-1/Rap2A/TNIK signaling pathway regulates neurite growth and arborization in mammalian neurons (PMID:20159449). Early research indicated that RAP2A is mainly located in the Golgi apparatus of mammalian cells. RAP2A functions in several cascade signals to regulate biological behaviors such as cytoskeletal rearrangement, cell growth and apoptosis, and cell adhesion and migration (PMID:34018090, PMID:16246175, PMID: 16540189).

Loading...
||
New chat

Able

正在加载,请稍候...