RAP2A Monoclonal antibody

RAP2A Monoclonal Antibody for WB, IF/ICC, ELISA
Cat No. 68368-1-Ig
Clone No.1F6F3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IF/ICC, ELISA

RbBP 30, Ras-related protein Rap-2a, Ras related protein Rap 2a, RAP2, EC:3.6.5.2

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68368-1-Ig targets RAP2A in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4979

Product name: Recombinant human RAP2A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-183 aa of BC041333

Sequence: MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ

Predict reactive species
Full Name RAP2A, member of RAS oncogene family
Calculated Molecular Weight 183 aa, 21 kDa
Observed Molecular Weight 21 kDa
GenBank Accession NumberBC041333
Gene Symbol RAP2A
Gene ID (NCBI) 5911
RRIDAB_3085088
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP10114
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ras-related protein Rap-2a (RAP2A) is also named as RbBP-30, and belongs to the small GTPase superfamily and Ras family. RAP2A is small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. In its active form, RAP2A can interact with and regulates several effectors including MAP4K4, MINK1 and TNIK. a Nedd4-1/Rap2A/TNIK signaling pathway regulates neurite growth and arborization in mammalian neurons (PMID:20159449). Early research indicated that RAP2A is mainly located in the Golgi apparatus of mammalian cells. RAP2A functions in several cascade signals to regulate biological behaviors such as cytoskeletal rearrangement, cell growth and apoptosis, and cell adhesion and migration (PMID:34018090, PMID:16246175, PMID: 16540189).

Protocols

Product Specific Protocols
WB protocol for RAP2A antibody 68368-1-IgDownload protocol
IF protocol for RAP2A antibody 68368-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...