RAP2A Monoclonal antibody

• 

  WB analysis using 68368-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68368-1-Ig (RAP2A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  IF Staining of MCF-7 using 68368-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using RAP2A antibody (68368-1-Ig, Clone: 1F6F3 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002).

RAP2A Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 68368-1-Ig

Clone No.1F6F3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IF/ICC, ELISA

Synonyms

RbBP 30, Ras-related protein Rap-2a, Ras related protein Rap 2a, RAP2, EC:3.6.5.2

---

Tested Applications

• Positive WB detected in: pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68368-1-Ig targets RAP2A in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4979

  Product name: Recombinant human RAP2A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-183 aa of BC041333

  Sequence: MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ

• Full Name: RAP2A, member of RAS oncogene family
• Calculated Molecular Weight: 183 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC041333
• Gene Symbol: RAP2A
• Gene ID (NCBI): 5911
• RRID: AB_3085088
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P10114
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ras-related protein Rap-2a (RAP2A) is also named as RbBP-30, and belongs to the small GTPase superfamily and Ras family. RAP2A is small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. In its active form, RAP2A can interact with and regulates several effectors including MAP4K4, MINK1 and TNIK. a Nedd4-1/Rap2A/TNIK signaling pathway regulates neurite growth and arborization in mammalian neurons (PMID:20159449). Early research indicated that RAP2A is mainly located in the Golgi apparatus of mammalian cells. RAP2A functions in several cascade signals to regulate biological behaviors such as cytoskeletal rearrangement, cell growth and apoptosis, and cell adhesion and migration (PMID:34018090, PMID:16246175, PMID: 16540189).