RAP2C Polyclonal antibody

• 

  WB analysis using 33845-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33845-1-AP (RAP2C antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

RAP2C Polyclonal Antibody for WB, ELISA

Cat No. 33845-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Ras-related protein Rap-2c

---

Tested Applications

• Positive WB detected in: HCT 116 cells, HeLa cells, MCF-7 cells, SW480 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33845-1-AP targets RAP2C in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38723

  Product name: Recombinant human RAP2C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-183 aa of BC003403

  Sequence: MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALVQEWGCPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTCVVQ

• Full Name: RAP2C, member of RAS oncogene family
• Calculated Molecular Weight: 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC003403
• Gene Symbol: RAP2C
• Gene ID (NCBI): 57826
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y3L5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAP2C is a member of the Ras superfamily, which is the promoter of tumorigenesis. RAP2C plays a key role in the migration and invasion of various tumors, such as osteosarcoma, glioma, and small cell lung cancer (SCLC).(PMID: 29552178; PMID: 32341653; PMID: 33302819)