RARA Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RARA Polyclonal antibody (10331-1-AP)

RARA Polyclonal Antibody for WB, ELISA

Cat No. 10331-1-AP Copied!

Publications (16)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

NR1B1, RAR, RAR alpha, RAR-alpha, Retinoic acid receptor alpha

• 

  WB analysis using 10331-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10331-1-AP (RARA antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RARA in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, MCF-7 cells, MDA-MB-231 cells, NIH/3T3 cells, T-47D cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10331-1-AP targets RARA in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0420

  Product name: Recombinant human RARA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 80-421 aa of BC008727

  Sequence: PLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLD

• Full Name: retinoic acid receptor, alpha
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC008727
• Gene Symbol: RARA
• Gene ID (NCBI): 5914
• RRID: AB_2177742
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10276
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Retinoic acid receptors (RARs) function as nuclear receptors that control gene expression in response to binding of the ligand retinoic acid (RA). Retinoic acid receptor alpha (RARα), also known as NR1B1 (nuclear receptor subfamily 1, group B, member 1), plays an essential role in the regulation of retinoic acid-induced germ cell development during spermatogenesis. Formation of a complex with histone deacetylases might lead to inhibition of RARE DNA element binding and to transcriptional repression (PubMed:28167758). Transcriptional activation and RARE DNA element binding might be supported by the transcription factor KLF2 (PubMed:28167758).

Publications

What published studies show

The RARA Polyclonal antibody (Cat# 10331-1-AP) has 16 citations across journals including Nature Immunology, Metabolism, British Journal of Cancer, Cell Signaling, iScience, eLife, American Journal of Pathology, Stem Cell Reviews and Reports, Biomedicines, Andrology, Frontiers in Nutrition, Frontiers in Cell and Developmental Biology, Frontiers in Veterinary Science, Veterinary Quarterly, and British Journal of Pharmacology. Research fields span retinoic acid signaling, cancer, diabetes, liver fibrosis, lipid metabolism, hematopoiesis, neural differentiation, viral replication, and reproductive biology.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Immunol; Targeting autocrine retinoic acid signaling by ALDH1A2 inhibition enhances antitumor dendritic cell vaccine efficacy.; Authors - Cao Fang
mouse	WB,IHC	Metabolism; Disruption of retinoid homeostasis induces RBP4 overproduction in diabetes: O-GlcNAcylation involved.; Authors - Shyi-Jang Shin
human	WB	Br J Cancer; All-trans retinoic acid enhances the cytotoxic effect of decitabine on myelodysplastic syndromes and acute myeloid leukaemia by activating the RARα-Nrf2 complex; Authors - Lu Wang
		Front Nutr; Asiatic acid from Centella asiatica alleviates renal fibrosis: coordinated modulation of the gut-kidney axis and retinol metabolism.; Authors - Liwei Zhu
human	WB	Front Cell Dev Biol; Silybin Prevents Prostate Cancer by Inhibited the ALDH1A1 Expression in the Retinol Metabolism Pathway.; Authors - Ying Jiang
human	IF	Stem Cell Rev Rep; Pulse Activation of Retinoic Acid Receptor Enhances Hematopoietic Stem Cell Homing by Controlling CXCR4 Membrane Presentation; Authors - Nanxi Geng