RARS Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 66815-1-Ig (same clone as 66815-1-PBS)

  WB result of RARS antibody (66815-1-Ig; 1:60000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RARS transfected HeLa cells. This data was developed using the same antibody clone with 66815-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66815-1-Ig (same clone as 66815-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66815-1-Ig (RARS antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66815-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66815-1-Ig (same clone as 66815-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66815-1-Ig (RARS antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66815-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66815-1-Ig (same clone as 66815-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66815-1-Ig (RARS antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66815-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66815-1-Ig (same clone as 66815-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using RARS antibody (66815-1-Ig, Clone: 1C8G4 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66815-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RARS Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66815-1-PBS

Clone No.1C8G4

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

DALRD1, ArgRS, Arginyl-tRNA synthetase, arginyl tRNA synthetase, Arginine--tRNA ligase, cytoplasmic

---

Product Information

66815-1-PBS targets RARS in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26399

  Product name: Recombinant human RARS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-190 aa of BC000528

  Sequence: MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRKSLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGE

• Full Name: arginyl-tRNA synthetase
• Calculated Molecular Weight: 75 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC000528
• Gene Symbol: RARS
• Gene ID (NCBI): 5917
• RRID: AB_2882158
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P54136
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RARS, also named ArgRS (arginyl-tRNA synthetase), belongs to the class-I aminoacyl-tRNA synthetase family which catalyze the aminoacylation of tRNA by their cognate amino acid. In higher eukaryotes, one of the two arginyl-tRNA synthetases (ArgRSs) has evolved to have an extended N-terminal domain that plays a crucial role in protein synthesis and cell growth and in integration into the multisynthetase complex (MSC) (PMID:25288775). RARS has two isoforms with the molecular weight of 75 and 67 kDa.