RARS Monoclonal antibody

• Home
• Products
• Primary Antibodies
• RARS Monoclonal antibody (66815-1-Ig)

• Featured Product
• KD/KO Validated

RARS Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66815-1-Ig Copied!

Clone No. 1C8G4

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA
For FC, select conjugated version.

Synonyms

1C8G4, Arginine--tRNA ligase, cytoplasmic, arginyl tRNA synthetase, Arginyl-tRNA synthetase, ArgRS

• 

  WB analysis using 66815-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66815-1-Ig (RARS antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 66815-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66815-1-Ig (RARS antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 66815-1-Ig

  WB result of RARS antibody (66815-1-Ig; 1:60000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RARS transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 66815-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66815-1-Ig (RARS antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 66815-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using RARS antibody (66815-1-Ig, Clone: 1C8G4 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RARS in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HSC-T6 cells, MCF-7 cells, A431 cells, HEK-293 cells, HepG2 cells, NIH/3T3 cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:3000-1:8000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66815-1-Ig targets RARS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26399

  Product name: Recombinant human RARS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-190 aa of BC000528

  Sequence: MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRKSLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGE

• Full Name: arginyl-tRNA synthetase
• Calculated Molecular Weight: 75 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC000528
• Gene Symbol: RARS
• Gene ID (NCBI): 5917
• RRID: AB_2882158
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P54136
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RARS, also named ArgRS (arginyl-tRNA synthetase), belongs to the class-I aminoacyl-tRNA synthetase family which catalyze the aminoacylation of tRNA by their cognate amino acid. In higher eukaryotes, one of the two arginyl-tRNA synthetases (ArgRSs) has evolved to have an extended N-terminal domain that plays a crucial role in protein synthesis and cell growth and in integration into the multisynthetase complex (MSC) (PMID:25288775). RARS has two isoforms with the molecular weight of 75 and 67 kDa.

Publications

What published studies show

The RARS Monoclonal antibody (1C8G4), catalog number 66815-1-Ig, has a total of 1 citation. The citation appears in iScience (2025), a multidisciplinary science journal. The associated research field involves protein synthesis and endoplasmic reticulum biology, specifically examining the variant-specific interaction of kinectin 1 with the multi-tRNA synthetase complex and its role in ER sheet organization. The study utilized this antibody for WB, IHC, and IF applications across human, mouse, and rat species.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat,mouse,human	WB,IHC,IF	iScience; Variant-specific interaction of kinectin 1 with the multi-tRNA synthetase complex regulates ER sheet organization.; Authors - Masaki Hosogane