RASGEF1B Polyclonal antibody

• 

  WB analysis of human brain using 13617-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 13617-1-AP (RASGEF1B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 13617-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 13617-1-AP (RASGEF1B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse ovary using 13617-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 13617-1-AP (RASGEF1B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach using 13617-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach using 13617-1-AP (RASGEF1B antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human stomach using 13617-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach using 13617-1-AP (RASGEF1B antibody) at dilution of 1:50 (under 40x lens).

RASGEF1B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13617-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

GPI gamma 4, GPIG4, RASGEF1B

---

Tested Applications

• Positive WB detected in: human brain tissue, mouse lung tissue, mouse ovary tissue
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13617-1-AP targets RASGEF1B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4525

  Product name: Recombinant human RASGEF1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-210 aa of BC036784

  Sequence: MPQTPPFSAMFDSSGYNRNLYQSAEDSCGGLYYHDNNLLSGSLEALIQHLVPNVDYYPDRTYIFTFLLSSRLFMHPYELMAKVCHLCVEHQRLSDPDSDKNQMRKIAPKILQLLTEWTETFPYDFRDERMMRNLKDLAHRIASGEEVGNLNLARLLEFPGRAWVGNGAELCILISTASSLFCLWASPPHHILVYLVCQVRMIIPSHFKGI

• Full Name: RasGEF domain family, member 1B
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC036784
• Gene Symbol: RASGEF1B
• Gene ID (NCBI): 153020
• RRID: AB_10644147
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q0VAM2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RASGEF1B is a guanine-nucleotide exchange factor, whose expression is induced inmacrophages on stimulation by TLR2 and TLR4 agonists. It interacts with Ras family proteins. It also interacts with CCDC124 during cytokinesis.