RASGRP3 Monoclonal antibody, PBS Only

RASGRP3 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 66650-1-PBS
Clone No.1A10G4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse

Applications

WB, IF/ICC, Indirect ELISA

GRP3, KIAA0846, Ras guanyl releasing protein 3, RAS-GRP, RASGRP3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66650-1-PBS targets RASGRP3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3810

Product name: Recombinant human RASGRP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 342-690 aa of BC027849

Sequence: SLQNASHHLEPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKHIRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG

Predict reactive species
Full Name RAS guanyl releasing protein 3 (calcium and DAG-regulated)
Calculated Molecular Weight 690 aa, 78 kDa
Observed Molecular Weight 78 kDa
GenBank Accession NumberBC027849
Gene Symbol RASGRP3
Gene ID (NCBI) 25780
RRIDAB_2882007
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8IV61
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

AS guanyl releasing protein 3 (RasGRP3) is a member of the RasGRP family and is able to promote guanine nucleotide exchange of Ha-Ras, R-Ras and Rap1 (PMID: 9582122). RasGRP3 is involved in a diverse range of important biological processes. RasGRP3 has emerged as an important mediator of signaling downstream from receptor coupled phosphoinositide turnover in B and T cells. Overexpression of RasGRP3 is commonly associated with many malignancies, such as pre-Bcell leukemia, Burkitt’s lymphoma and natural killer-like T-cell leukemia. Recently, it has been reported that upregulation of RASGRP3 expression in prostate cancer correlates with aggressive capabilities and predicts biochemical recurrence after radical prostatectomy (PMID: 24418912).

Loading...
||
New chat Able
正在加载,请稍候...