RASGRP3 Monoclonal antibody, PBS Only

• 

  WB analysis using 66650-1-Ig (same clone as 66650-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66650-1-Ig (RASGRP3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66650-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66650-1-Ig (same clone as 66650-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66650-1-Ig (RASGRP3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66650-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66650-1-Ig (same clone as 66650-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66650-1-Ig (RASGRP3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66650-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 66650-1-Ig (same clone as 66650-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using RASGRP3 antibody (66650-1-Ig, Clone: 1A10G4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66650-1-PBS in a different storage buffer formulation.

RASGRP3 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 66650-1-PBS

Clone No.1A10G4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

GRP3, KIAA0846, Ras guanyl releasing protein 3, RAS-GRP, RASGRP3

---

Product Information

66650-1-PBS targets RASGRP3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3810

  Product name: Recombinant human RASGRP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 342-690 aa of BC027849

  Sequence: SLQNASHHLEPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKHIRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG

• Full Name: RAS guanyl releasing protein 3 (calcium and DAG-regulated)
• Calculated Molecular Weight: 690 aa, 78 kDa
• Observed Molecular Weight: 78 kDa
• GenBank Accession Number: BC027849
• Gene Symbol: RASGRP3
• Gene ID (NCBI): 25780
• RRID: AB_2882007
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IV61
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AS guanyl releasing protein 3 (RasGRP3) is a member of the RasGRP family and is able to promote guanine nucleotide exchange of Ha-Ras, R-Ras and Rap1 (PMID: 9582122). RasGRP3 is involved in a diverse range of important biological processes. RasGRP3 has emerged as an important mediator of signaling downstream from receptor coupled phosphoinositide turnover in B and T cells. Overexpression of RasGRP3 is commonly associated with many malignancies, such as pre-Bcell leukemia, Burkitt’s lymphoma and natural killer-like T-cell leukemia. Recently, it has been reported that upregulation of RASGRP3 expression in prostate cancer correlates with aggressive capabilities and predicts biochemical recurrence after radical prostatectomy (PMID: 24418912).