RASGRP3 Monoclonal antibody

• 

  WB analysis using 66650-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66650-1-Ig (RASGRP3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 66650-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66650-1-Ig (RASGRP3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 66650-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66650-1-Ig (RASGRP3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HEK-293 using 66650-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using RASGRP3 antibody (66650-1-Ig, Clone: 1A10G4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

RASGRP3 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 66650-1-Ig

Clone No.1A10G4

Reviews (1)

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

GRP3, KIAA0846, Ras guanyl releasing protein 3, RASGRP3

---

Tested Applications

• Positive WB detected in: Raji cells, HEK-293 cells, Jurkat cells, Ramos cells, Raw 264.7 cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66650-1-Ig targets RASGRP3 in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3810

  Product name: Recombinant human RASGRP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 342-690 aa of BC027849

  Sequence: SLQNASHHLEPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKHIRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG

• Full Name: RAS guanyl releasing protein 3 (calcium and DAG-regulated)
• Calculated Molecular Weight: 690 aa, 78 kDa
• Observed Molecular Weight: 78 kDa
• GenBank Accession Number: BC027849
• Gene Symbol: RASGRP3
• Gene ID (NCBI): 25780
• RRID: AB_2882007
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IV61
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AS guanyl releasing protein 3 (RasGRP3) is a member of the RasGRP family and is able to promote guanine nucleotide exchange of Ha-Ras, R-Ras and Rap1 (PMID: 9582122). RasGRP3 is involved in a diverse range of important biological processes. RasGRP3 has emerged as an important mediator of signaling downstream from receptor coupled phosphoinositide turnover in B and T cells. Overexpression of RasGRP3 is commonly associated with many malignancies, such as pre-Bcell leukemia, Burkitt’s lymphoma and natural killer-like T-cell leukemia. Recently, it has been reported that upregulation of RASGRP3 expression in prostate cancer correlates with aggressive capabilities and predicts biochemical recurrence after radical prostatectomy (PMID: 24418912).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Carly (Verified Customer) (09-27-2019)

Used in an antibody array to identify proteins in human EDTA plasma.

• Applications: Other,