RBBP5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RBBP5 Polyclonal antibody (13181-1-AP)

RBBP5 Polyclonal Antibody for WB, ELISA

Cat No. 13181-1-AP Copied!

Publications (1)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

RBBP 5, RBBP5, RBQ3, SWD1

• 

  WB analysis of HL-60 using 13181-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 13181-1-AP (RBBP5 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 13181-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 13181-1-AP (RBBP5 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 13181-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 13181-1-AP (RBBP5 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 13181-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13181-1-AP (RBBP5 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RBBP5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HL-60 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13181-1-AP targets RBBP5 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3848

  Product name: Recombinant human RBBP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-327 aa of BC037284

  Sequence: MNLELLESFGQNYPEEADGTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGDCDQRFRFPSPILKVQYHPRDQNKVLVCPMKSAPVMLTLSDSKHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTDSQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGVVSIWAQNQVE

• Full Name: retinoblastoma binding protein 5
• Calculated Molecular Weight: 538 aa, 59 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC037284
• Gene Symbol: RBBP5
• Gene ID (NCBI): 5929
• RRID: AB_2177773
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15291
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RBQ-3, also known as RBBP5 (retinoblastoma binding protein 5) or SWD1, is a 538 amino acid protein that localizes to the nucleus and contains six WD repeats. Expressed ubiquitously, RBQ-3 functions as a component of the Set1 complex and preferentially binds to underphosphorylated forms of the retinoblastoma (Rb) protein, possibly playing a role in the regulation of cell proliferation. RBQ-3 exists as two alternatively spliced isoforms and, upon DNA damage, is subject to phosphorylation by ATM or ATR.

Publications

What published studies show

The RBBP5 Polyclonal antibody (Cat# 13181-1-AP) has 1 citation. It was cited in Nature Communications in a 2017 study investigating how Menin enhances c-Myc-mediated transcription to promote cancer progression. The antibody was used for Western blot in human samples. The associated research field is oncology, specifically transcriptional regulation and cancer cell proliferation.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Menin enhances c-Myc-mediated transcription to promote cancer progression.; Authors - Gongwei Wu

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The antibody received a 5-star rating from Carlos Aguilar (Nov 2025), who reported it "worked well straightaway" for Western Blot using lot 00040899. The single review reflects a positive experience with immediate success in the application.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Carlos (Verified Customer) (11-14-2025)

Worked well straightaway

• Applications: Western Blot