RBM11 Polyclonal antibody

• 

  WB analysis of HEK-293 using 17220-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17220-1-AP (RBM11 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 17220-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17220-1-AP (RBM11 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

• 

  IP experiment of HEK-293 using 17220-1-AP

  IP result of anti-RBM11 (IP:17220-1-AP, 4ug; Detection:17220-1-AP 1:300) with HEK-293 cells lysate 3000ug.

• 

  IF Staining of HEK-293 using 17220-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HEK-293 cells using 17220-1-AP (RBM11 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

RBM11 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 17220-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, ELISA

Synonyms

RBM11, RNA binding motif protein 11

---

Tested Applications

• Positive WB detected in: HEK-293 cells
• Positive IP detected in: HEK-293 cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

17220-1-AP targets RBM11 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11040

  Product name: Recombinant human RBM11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-218 aa of BC030196

  Sequence: MFPAQEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTICKDREGKPKSFGFVCFKHPESVSYAIALLNGIRLYGRPINVQYRFGSSRSSEPANQSFESCVKINSHNYRNEEMLVGRSSFPMQYFPINNTSLPQEYFLFQKMQWHVYNPVLQLPYYEMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNRGNECSQKFRKSKKKKRY

• Full Name: RNA binding motif protein 11
• Calculated Molecular Weight: 281 aa, 32 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC030196
• Gene Symbol: RBM11
• Gene ID (NCBI): 54033
• RRID: AB_2175729
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P57052
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Dis Markers; RNA-Binding Motif Protein 11 (RBM11) Serves as a Prognostic Biomarker and Promotes Ovarian Cancer Progression.; Authors - Chunhong Fu ; KD Validated