RBM11 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RBM11 Polyclonal antibody (17220-1-AP)

• Featured Product
• KD/KO Validated

RBM11 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 17220-1-AP Copied!

Publications (1)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, ELISA

Synonyms

RBM11, RNA binding motif protein 11

• 

  WB analysis of HEK-293 using 17220-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17220-1-AP (RBM11 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 17220-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17220-1-AP (RBM11 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 17220-1-AP

  IP result of anti-RBM11 (IP:17220-1-AP, 4ug; Detection:17220-1-AP 1:300) with HEK-293 cells lysate 3000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 17220-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HEK-293 cells using 17220-1-AP (RBM11 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RBM11 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells
• Positive IP detected in: HEK-293 cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17220-1-AP targets RBM11 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11040

  Product name: Recombinant human RBM11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-218 aa of BC030196

  Sequence: MFPAQEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTICKDREGKPKSFGFVCFKHPESVSYAIALLNGIRLYGRPINVQYRFGSSRSSEPANQSFESCVKINSHNYRNEEMLVGRSSFPMQYFPINNTSLPQEYFLFQKMQWHVYNPVLQLPYYEMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNRGNECSQKFRKSKKKKRY

• Full Name: RNA binding motif protein 11
• Calculated Molecular Weight: 281 aa, 32 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC030196
• Gene Symbol: RBM11
• Gene ID (NCBI): 54033
• RRID: AB_2175729
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P57052
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RBM11 Polyclonal antibody (catalog number 17220-1-AP) has a total of 1 citation. It appears in the journal Dis Markers, in a study examining RBM11 as a prognostic biomarker that promotes ovarian cancer progression. The associated research field is oncology, specifically ovarian cancer, with the antibody applied in Western blot (WB) using human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Dis Markers; RNA-Binding Motif Protein 11 (RBM11) Serves as a Prognostic Biomarker and Promotes Ovarian Cancer Progression.; Authors - Chunhong Fu ; KD Validated

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The single review for this product is a 5-star rating. The user performed a Western Blot on HEK293T cells at a 1:3000 dilution and described the antibody as "excellent." Overall, the feedback is highly positive, indicating strong performance in WB applications.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Tsimafei (Verified Customer) (07-13-2026)

Excellent antibody

• Applications: Western Blot
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: HEK293T

RBM11 Antibody Western Blot validation (1:3000 dilution) in HEK293T (Cat no:17220-1-AP)