RBM11 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RBM11 Polyclonal antibody, PBS Only (17220-1-PBS)

• 

  WB analysis of HEK-293 using 17220-1-AP (same clone as 17220-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17220-1-AP (RBM11 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17220-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 17220-1-AP (same clone as 17220-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17220-1-AP (RBM11 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 17220-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 17220-1-AP (same clone as 17220-1-PBS)

  IP result of anti-RBM11 (IP:17220-1-AP, 4ug; Detection:17220-1-AP 1:300) with HEK-293 cells lysate 3000ug. This data was developed using the same antibody clone with 17220-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 17220-1-AP (same clone as 17220-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed HEK-293 cells using 17220-1-AP (RBM11 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 17220-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RBM11 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 17220-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

17220-1-PBS targets RBM11 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11040

  Product name: Recombinant human RBM11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-218 aa of BC030196

  Sequence: MFPAQEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTICKDREGKPKSFGFVCFKHPESVSYAIALLNGIRLYGRPINVQYRFGSSRSSEPANQSFESCVKINSHNYRNEEMLVGRSSFPMQYFPINNTSLPQEYFLFQKMQWHVYNPVLQLPYYEMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNRGNECSQKFRKSKKKKRY

• Full Name: RNA binding motif protein 11
• Calculated Molecular Weight: 281 aa, 32 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC030196
• Gene Symbol: RBM11
• Gene ID (NCBI): 54033
• RRID: AB_2175729
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P57052
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.