RBM15B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RBM15B Polyclonal antibody (22249-1-AP)

• Featured Product
• KD/KO Validated

RBM15B Polyclonal Antibody for WB, IP, ELISA

Cat No. 22249-1-AP Copied!

Publications (19)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, CoIP, RIP, ELISA

Synonyms

HUMAGCGB, HuOTT3, One twenty two protein 3, OTT3, RBM15B, RNA binding motif protein 15B

• 

  WB analysis of HeLa using 22249-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 22249-1-AP (RBM15B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 22249-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 22249-1-AP (RBM15B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 22249-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 22249-1-AP (RBM15B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 22249-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 22249-1-AP (RBM15B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 22249-1-AP

  IP result of anti-RBM15B (IP:22249-1-AP, 4ug; Detection:22249-1-AP 1:500) with HeLa cells lysate 2500ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RBM15B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, mouse brain tissue
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22249-1-AP targets RBM15B in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17744

  Product name: Recombinant human RBM15B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 490-769 aa of BC001367

  Sequence: AKAEETRYPQQYQPSPLPVHYELLTDGYTRHRNLDADLVRDRTPPHLLYSDRDRTFLEGDWTSPSKSSDRRNSLEGYSRSVRSRSGERWGADGDRGLPKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGSGQQSERGSDRTPERSRKENHSSEGTKESSSNSLSNSRHGAEERGHHHHHHEAADSSHGKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISSLLKDHTSGSKLTQLKIAQRL

• Full Name: RNA binding motif protein 15B
• Calculated Molecular Weight: 890 aa, 97 kDa
• Observed Molecular Weight: 100-120 kDa, 70 kDa
• GenBank Accession Number: BC001367
• Gene Symbol: RBM15B
• Gene ID (NCBI): 29890
• RRID: AB_2879048
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NDT2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RBM15B, one members of the SPEN (Split-end) family of proteins, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components. Present polyclonal anti-RBM15B antibody was produced by immunizing animals with C-terminus of RBM15B, which homolog with a short form of RBM15B(563aa, ~70kDa), thus this antibody can recognize full length of RBM15B(~100kDa) and splice-one(70kDa)

Publications

What published studies show

Anti-METTL3 antibody (Cat# 22249-1-AP) has 19 citations published across 18 journals, including Nature, Molecular Cell, EMBO Journal, Cell Reports, Cancer Letters, eLife, and Cell Death & Disease. Research fields span m6A RNA methylation regulation, cancer biology (gastric, bladder, colorectal, esophageal, glioma, lung, renal), neurodegeneration (Alzheimer's disease), stem cell biology, and chronic kidney disease. Applications include WB, IP/CoIP, RIP, IHC, and IF.

Automatically generated from the 19 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; METTL3 regulates heterochromatin in mouse embryonic stem cells.; Authors - Wenqi Xu ; KO Validated
human	WB	Drug Resist Updat; RNA-binding motif protein 15 promotes gastric cancer growth and drug resistance via USP10-mediated deubiquitination and stabilization of nuclear NRF2.; Authors - Zhuang Ma
human	WB	Mol Cell; mTORC1 stimulates cell growth through SAM synthesis and m6A mRNA-dependent control of protein synthesis.; Authors - Elodie Villa
human	WB	Mol Cell; A lncRNA from the FTO locus acts as a suppressor of the m6A writer complex and p53 tumor suppression signaling; Authors - Jianong Zhang
human	WB	Cell Death Dis; XIST and MUC1-C form an auto-regulatory pathway in driving cancer progression; Authors - Keyi Wang
human	WB	Cancer Lett; N6-methyladenosine-modified CircPSMA7 enhances bladder cancer malignancy through the mir-128-3p/MAPK1 axis; Authors - Jiahe Yi