RBM15B Monoclonal antibody, PBS Only

• 

  WB analysis using 67506-1-Ig (same clone as 67506-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 67506-1-Ig (RBM15B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control. This data was developed using the same antibody clone with 67506-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67506-1-Ig (same clone as 67506-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67506-1-Ig (RBM15B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control. This data was developed using the same antibody clone with 67506-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67506-1-Ig (same clone as 67506-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67506-1-Ig (RBM15B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67506-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 67506-1-Ig (same clone as 67506-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67506-1-Ig (RBM15B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67506-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 67506-1-Ig (same clone as 67506-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 67506-1-Ig (RBM15B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67506-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67506-1-Ig (same clone as 67506-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67506-1-Ig (RBM15B antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67506-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67506-1-Ig (same clone as 67506-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67506-1-Ig (RBM15B antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67506-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 67506-1-Ig (same clone as 67506-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 67506-1-Ig (RBM15B antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67506-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat colon using 67506-1-Ig (same clone as 67506-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 67506-1-Ig (RBM15B antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67506-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat colon using 67506-1-Ig (same clone as 67506-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 67506-1-Ig (RBM15B antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67506-1-PBS in a different storage buffer formulation.

RBM15B Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67506-1-PBS

Clone No.1C2C11

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

1C2C11, HsOTT3, HUMAGCGB, HuOTT3, One-twenty two protein 3

---

Product Information

67506-1-PBS targets RBM15B in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17853

  Product name: Recombinant human RBM15B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 490-769 aa of BC001367

  Sequence: AKAEETRYPQQYQPSPLPVHYELLTDGYTRHRNLDADLVRDRTPPHLLYSDRDRTFLEGDWTSPSKSSDRRNSLEGYSRSVRSRSGERWGADGDRGLPKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGSGQQSERGSDRTPERSRKENHSSEGTKESSSNSLSNSRHGAEERGHHHHHHEAADSSHGKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISSLLKDHTSGSKLTQLKIAQRL

• Full Name: RNA binding motif protein 15B
• Calculated Molecular Weight: 890 aa, 97 kDa
• Observed Molecular Weight: 105 kDa
• GenBank Accession Number: BC001367
• Gene Symbol: RBM15B
• Gene ID (NCBI): 29890
• RRID: AB_2882729
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8NDT2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RBM15B, one members of the SPEN (Split-end) family of proteins, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components. Present polyclonal anti-RBM15B antibody was produced by immunizing animals with C-terminus of RBM15B, which homolog with a short form of RBM15B(563aa, ~70kDa).