RBM15B Monoclonal antibody

• 

  WB analysis using 67506-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 67506-1-Ig (RBM15B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control.

• 

  WB analysis using 67506-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67506-1-Ig (RBM15B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control.

• 

  WB analysis using 67506-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67506-1-Ig (RBM15B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 67506-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 67506-1-Ig (RBM15B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 67506-1-Ig

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 67506-1-Ig (RBM15B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67506-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67506-1-Ig (RBM15B antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 67506-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67506-1-Ig (RBM15B antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 67506-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 67506-1-Ig (RBM15B antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat colon using 67506-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 67506-1-Ig (RBM15B antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat colon using 67506-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 67506-1-Ig (RBM15B antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RBM15B Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67506-1-Ig

Clone No.1C2C11

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, IHC, ELISA

Synonyms

1C2C11, HsOTT3, HUMAGCGB, HuOTT3, One-twenty two protein 3

---

Tested Applications

• Positive WB detected in: HeLa cells, A549 cells, K-562 cells, COLO 320 cells, LNCaP cells, HEK-293 cells, Jurkat cells, THP-1 cells
• Positive IHC detected in: human colon cancer tissue, human colon tissue, rat colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

67506-1-Ig targets RBM15B in WB, IHC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17853

  Product name: Recombinant human RBM15B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 490-769 aa of BC001367

  Sequence: AKAEETRYPQQYQPSPLPVHYELLTDGYTRHRNLDADLVRDRTPPHLLYSDRDRTFLEGDWTSPSKSSDRRNSLEGYSRSVRSRSGERWGADGDRGLPKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGSGQQSERGSDRTPERSRKENHSSEGTKESSSNSLSNSRHGAEERGHHHHHHEAADSSHGKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISSLLKDHTSGSKLTQLKIAQRL

• Full Name: RNA binding motif protein 15B
• Calculated Molecular Weight: 890 aa, 97 kDa
• Observed Molecular Weight: 105 kDa
• GenBank Accession Number: BC001367
• Gene Symbol: RBM15B
• Gene ID (NCBI): 29890
• RRID: AB_2882729
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8NDT2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RBM15B, one members of the SPEN (Split-end) family of proteins, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components. Present polyclonal anti-RBM15B antibody was produced by immunizing animals with C-terminus of RBM15B, which homolog with a short form of RBM15B(563aa, ~70kDa).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Biol Chem; Wilms' Tumor 1-Associating Protein complex regulates alternative splicing and polyadenylation at potential G-quadruplex-forming splice site sequences.; Authors - Keiko Horiuchi
human	WB	Nat Commun; CSTF2 mediated mRNA N6-methyladenosine modification drives pancreatic ductal adenocarcinoma m6A subtypes; Authors - Yanfen Zheng