RBM8A,Y14 Monoclonal antibody, PBS Only

• 

  WB analysis using 67541-1-Ig (same clone as 67541-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67541-1-Ig (RBM8A,Y14 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67541-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67541-1-Ig (same clone as 67541-1-PBS)

  WB result of RBM8A,Y14 antibody (67541-1-Ig; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RBM8A,Y14 transfected HeLa cells. This data was developed using the same antibody clone with 67541-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67541-1-Ig (same clone as 67541-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67541-1-Ig (RBM8A,Y14 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67541-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 67541-1-Ig (same clone as 67541-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 67541-1-Ig (RBM8A,Y14 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67541-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 67541-1-Ig (same clone as 67541-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 67541-1-Ig (RBM8A,Y14 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67541-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 67541-1-Ig (same clone as 67541-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using RBM8A,Y14 antibody (67541-1-Ig, Clone: 1F5G1 ) at dilution of 1:2000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red). This data was developed using the same antibody clone with 67541-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RBM8A,Y14 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67541-1-PBS

Clone No.1F5G1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

RBM8A, BOV 1C, BOV 1B, BOV 1A, BOV 1

---

Product Information

67541-1-PBS targets RBM8A,Y14 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6800

  Product name: Recombinant human RBM8A,Y14 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-174 aa of BC017088

  Sequence: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR

• Full Name: RNA binding motif protein 8A
• Calculated Molecular Weight: 20 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC017088
• Gene Symbol: RBM8A
• Gene ID (NCBI): 9939
• RRID: AB_2882760
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9Y5S9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.