Product Information
27987-1-PBS targets RBMXL2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27624 Product name: Recombinant human RBMXL2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 271-392 aa of BC057796 Sequence: GDHLSRGSHREPFESYGELRGAAPGRGTPPSYGGGGRYEEYRGYSPDAYSGGRDSYSSSYGRSDRYSRGRHRVGRPDRGLSLSMERGCPPQRDSYSRSGCRVPRGGGRLGGRLERGGGRSRY Predict reactive species |
| Full Name | RNA binding motif protein, X-linked-like 2 |
| Calculated Molecular Weight | 43 kDa |
| Observed Molecular Weight | 43 kDa |
| GenBank Accession Number | BC057796 |
| Gene Symbol | RBMXL2 |
| Gene ID (NCBI) | 27288 |
| RRID | AB_3669632 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75526 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
RBMXL2 (RNA-binding motif protein, X-linked-like-2), also known as heterogeneous nuclear ribonucleoproteins G-testis or hnRNP-GT, is a testis-specific nuclear RNA binding protein that plays a crucial role in male meiosis (PMID: 34927545). The protein is part of an anciently diverged family of RNA-binding proteins and shares significant homology with RBMX, another RNA-binding protein that is important for controlling splicing, transcription, and genome stability (PMID: 39356106). The expression of RBMXL2 is restricted to the testis, and it is highly expressed during the pachytene and diplotene stages of meiosis, which are characterized by high levels of transcription and alternative splicing (PMID: 34927545).
