RBP3 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• RBP3 Monoclonal antibody (60921-3-Ig)

• 

  WB analysis using 60921-3-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60921-3-Ig (RBP3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rabbit retina using 60921-3-Ig

  rabbit retina tissue were subjected to SDS PAGE followed by western blot with 60921-3-Ig (RBP3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

RBP3 Monoclonal Antibody for WB, ELISA

Cat No. 60921-3-Ig

Clone No.3E6E6

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, rabbit

Applications

WB, ELISA

Synonyms

Interphotoreceptor retinoid-binding protein, Interstitial retinol-binding protein, Retinol binding protein 3, Retinol-binding protein 3

---

Tested Applications

• Positive WB detected in: rat retina tissue, rabbit retina tissue, mouse retina tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60921-3-Ig targets RBP3 in WB, ELISA applications and shows reactivity with human, mouse, rat, rabbit samples.

• Tested Reactivity: human, mouse, rat, rabbit
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6182

  Product name: Recombinant human RBP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 898-1247 aa of BC039844

  Sequence: AMSATTGKAWDLAGVEPDITVPMSEALSIAQDIVALRAKVPTVLQTAGKLVADNYASAELGAKMATKLSGLQSRYSRVTSEVALAEILGADLQMLSGDPHLKAAHIPENAKDRIPGIVPMQIPSPEVFEELIKFSFHTNVLEDNIGYLRFDMFGDGELLTQVSRLLVEHIWKKIMHTDAMIIDMRFNIGGPTSSIPILCSYFFDEGPPVLLDKIYSRPDDSVSELWTHAQVVGERYGSKKSMVILTSSVTAGTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSVGASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDHL

• Full Name: retinol binding protein 3, interstitial
• Calculated Molecular Weight: 135 kDa
• Observed Molecular Weight: 135 kDa
• GenBank Accession Number: BC039844
• Gene Symbol: RBP3
• Gene ID (NCBI): 5949
• RRID: AB_3743243
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10745
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RBP3 (retinoid-binding protein 3), also called interstitial retinoid-binding protein (IRBP), is a large glycoprotein that is synthesized and secreted by rod photoreceptor cells into the interphotoreceptor matrix. It is known to bind retinoids and fatty acids. RBP3 migrates around 136-140 kDa in the western blot analysis. (PMID: 15928609)