RBP3 Monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RBP3 Monoclonal antibody, PBS Only (60921-3-PBS)

• 

  WB analysis using 60921-3-Ig (same clone as 60921-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60921-3-Ig (RBP3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60921-3-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit retina using 60921-3-Ig (same clone as 60921-3-PBS)

  rabbit retina tissue were subjected to SDS PAGE followed by western blot with 60921-3-Ig (RBP3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60921-3-PBS in a different storage buffer formulation.

RBP3 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 60921-3-PBS

Clone No.3E6E6

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, rabbit

Applications

WB, Indirect ELISA

Synonyms

Interphotoreceptor retinoid-binding protein, Interstitial retinol-binding protein, Retinol binding protein 3, Retinol-binding protein 3

---

Product Information

60921-3-PBS targets RBP3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, rabbit samples.

• Tested Reactivity: human, mouse, rat, rabbit
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6182

  Product name: Recombinant human RBP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 898-1247 aa of BC039844

  Sequence: AMSATTGKAWDLAGVEPDITVPMSEALSIAQDIVALRAKVPTVLQTAGKLVADNYASAELGAKMATKLSGLQSRYSRVTSEVALAEILGADLQMLSGDPHLKAAHIPENAKDRIPGIVPMQIPSPEVFEELIKFSFHTNVLEDNIGYLRFDMFGDGELLTQVSRLLVEHIWKKIMHTDAMIIDMRFNIGGPTSSIPILCSYFFDEGPPVLLDKIYSRPDDSVSELWTHAQVVGERYGSKKSMVILTSSVTAGTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSVGASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDHL

• Full Name: retinol binding protein 3, interstitial
• Calculated Molecular Weight: 135 kDa
• Observed Molecular Weight: 135 kDa
• GenBank Accession Number: BC039844
• Gene Symbol: RBP3
• Gene ID (NCBI): 5949
• RRID: AB_3743243
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10745
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RBP3 (retinoid-binding protein 3), also called interstitial retinoid-binding protein (IRBP), is a large glycoprotein that is synthesized and secreted by rod photoreceptor cells into the interphotoreceptor matrix. It is known to bind retinoids and fatty acids. RBP3 migrates around 136-140 kDa in the western blot analysis. (PMID: 15928609)