CoraLite® Plus 488-conjugated RBP4 Recombinant monoclonal antibody

• 

  IF Staining of mouse liver using CL488-84503-4

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using CoraLite® Plus 488 RBP4 antibody (CL488-84503-4, Clone: 242040D6 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse liver using CL488-84503-4

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using CoraLite® Plus 488 RBP4 antibody (CL488-84503-4, Clone: 242040D6 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RBP4 Uni-rAb^® Recombinant Antibody for IF-P

Cat No. CL488-84503-4

Clone No.242040D6

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

IF-P

Synonyms

242040D6, Plasma retinol-binding protein, PRBP, RBP, Retinol-binding protein 4

---

Tested Applications

• Positive IF-P detected in: mouse liver tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84503-4 targets RBP4 in IF-P applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1140

  Product name: Recombinant Mouse RBP4 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 19-201 aa of NM_011255.3

  Sequence: ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL

• Full Name: retinol binding protein 4, plasma
• Calculated Molecular Weight: 23kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: NM_011255.3
• Gene Symbol: Rbp4
• Gene ID (NCBI): 19662
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q00724
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

RBP4 (retinol-binding protein 4) is a carrier protein that transports vitamin A (retinol) from the liver to the peripheral tissues. Synthesized primarily by hepatocytes and adipocytes as a 21 kDa non-glycosylated protein, RBP4 is secreted into the circulation as a retinol-RBP4 complex. In plasma the RBP4-retinol complex is bound to transthyretin (TRR), which prevents prevent kidney filtration. Two truncated forms of RBP4, RBP4-L (truncated at Leu-183) and RBP4-LL (truncated at Leu-182 and Leu-183), exist by proteolytic process. RBP4-L and RBP4-LL, which do not bind TTR, are normally excreted into the urine but accumulate in the serum during renal failure. Urinary RBP4 has been reported as marker for glomerular disease. RBP4 also was identified as an adipokine that elevated in some INS-resistant states. Measurement of serum RBP4 could be used to assess the risk of INS resistance, type 2 diabetes, obesity, and cardiovascular disease. (18752671, 16034410)