RCC1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67335-1-Ig (same clone as 67335-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67335-1-Ig (RCC1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67335-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67335-1-Ig (same clone as 67335-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67335-1-Ig (RCC1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67335-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 67335-1-Ig (same clone as 67335-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 67335-1-Ig (RCC1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67335-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 67335-1-Ig (same clone as 67335-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 67335-1-Ig (RCC1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67335-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67335-1-Ig (same clone as 67335-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67335-1-Ig (RCC1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67335-1-PBS in a different storage buffer formulation.

RCC1 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67335-1-PBS

Clone No.2C2F5

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Cell cycle regulatory protein, CHC1, RCC1, RCC1 I

---

Product Information

67335-1-PBS targets RCC1 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17809

  Product name: Recombinant human RCC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-421 aa of BC010067

  Sequence: MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS

• Full Name: regulator of chromosome condensation 1
• Calculated Molecular Weight: 421 aa, 45 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC010067
• Gene Symbol: RCC1
• Gene ID (NCBI): 1104
• RRID: AB_2882593
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P18754
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CHC1, also named as RCC1, promotes the exchange of ran-bound gdp by gtp. It is involved in the regulation of onset of chromosome condensation in the S-phase. Phosphorylation of RCC1 on serines located in or near its nuclear localization signal activates RCC1 to generate RanGTP on mitotic chromosomes, which is required for spindle assembly and chromosome segregation.