CoraLite® Plus 488-conjugated RCN1 Recombinant monoclonal antibody

RCN1 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-83638-3
Clone No.240473E9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Reticulocalbin 1, 240473E9, PIG20, RCAL, RCN

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inU2OS cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83638-3 targets RCN1 in applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13256

Product name: Recombinant human RCN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-272 aa of BC010120

Sequence: MARGGRGRRLGLALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHW

Predict reactive species
Full Name reticulocalbin 1, EF-hand calcium binding domain
Calculated Molecular Weight 39 kDa
Observed Molecular Weight 44-46 kDa
GenBank Accession NumberBC010120
Gene Symbol RCN1
Gene ID (NCBI) 5954
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ15293
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Reticulocalbin-1 (RCN1) belongs to the CREC family. Reticulocalbin‐1, an endoplasmic reticulum protein, plays a crucial role in calcium homeostasis and inhibits ER stress‐induced apoptosis (PMID: 28319095). Its main functions include maintaining intracellular homeostasis and regulating cell proliferation and apoptosis, and it plays an important role in the development of various tumours (PMID: 38057406). RCN1 is expressed aberrantly and at a high level in various tumors, including acute myeloid leukemia (AML) (PMID: 37746742). In multiple cancers, such as glioblastoma, non‐small cell lung cancer, renal cell carcinoma, hepatocellular carcinoma, and oral squamous cell carcinoma, the overexpression of RCN1 has been observed indicating its involvement in tumorigenesis and invasion (PMID: 30172915, PMID: 34722631).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 RCN1 antibody CL488-83638-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...