RDM1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RDM1 Polyclonal antibody, PBS Only (20156-1-PBS)

• 

  WB analysis of PC-3 using 20156-1-AP (same clone as 20156-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 20156-1-AP (RDM1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20156-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 20156-1-AP (same clone as 20156-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 20156-1-AP (RDM1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20156-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 20156-1-AP (same clone as 20156-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 20156-1-AP (RDM1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20156-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 20156-1-AP (same clone as 20156-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 20156-1-AP (RDM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20156-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 20156-1-AP (same clone as 20156-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 20156-1-AP (RDM1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20156-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 20156-1-AP (same clone as 20156-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 20156-1-AP (RDM1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20156-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 20156-1-AP (same clone as 20156-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 20156-1-AP (RDM1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 20156-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 20156-1-AP (same clone as 20156-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 20156-1-AP (RDM1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20156-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 20156-1-AP (same clone as 20156-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 20156-1-AP (RDM1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 20156-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 20156-1-AP (same clone as 20156-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed PC-3 cells using 20156-1-AP (RDM1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 20156-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RDM1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 20156-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

20156-1-PBS targets RDM1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14077

  Product name: Recombinant human RDM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-253 aa of BC038301

  Sequence: QHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSARAAHRAQKACDRKQLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANYCFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLVEEPMDKVEEGPLSFLMKRKTAQKLAIQKALSDAFQKLLIVVLESGKIAVEYRPSEDIVGVRCEEELHGLIQVPCSPWKQYGQEEEGYLSDFSLEEEEFRLPELD

• Full Name: RAD52 motif 1
• Calculated Molecular Weight: 284 aa, 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC038301
• Gene Symbol: RDM1
• Gene ID (NCBI): 201299
• RRID: AB_10666433
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NG50
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RDM1, also named as RAD52B, encodes a RNA recognition motif (RRM)-containing protein confered resistance to the antitumor agent cisplatin. The expression of RDM1 is closely related to the cell proliferation and apoptosis of thyroid carcinoma cells and RDM1 may be a potential marker of lung adenocarcinoma. RDM1 has many isoforms (8 kDa, 12-19 kDa and 25-32 kDa) with long or short N-terminus and a great diversity in the exonic composition of C-terminus generated by alternative pre-mRNA splicing and differential usage of two translational start sites. RDM1 protein can be expressed differently in cytoplasm or nuclear/nucleolar in the absence of stress, proteotoxic stress and mild heat shock, suggesting functional differences among the RDM1 proteins. ( PMID: 28939762, 17905820, 28939762, 30069034)