RDM1 Monoclonal antibody

• 

  WB analysis of PC-3 using 66941-1-Ig

  PC-3 cells were subjected to SDS PAGE followed by western blot with 66941-1-Ig (RDM1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HSC-T6 using 66941-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66941-1-Ig (RDM1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 66941-1-Ig

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 66941-1-Ig (RDM1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 66941-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66941-1-Ig (RDM1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human thyroid cancer using 66941-1-Ig

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 66941-1-Ig (RDM1 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 66941-1-Ig

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 66941-1-Ig (RDM1 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 66941-1-Ig

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 66941-1-Ig (RDM1 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 66941-1-Ig

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 66941-1-Ig (RDM1 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 66941-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using RDM1 antibody (66941-1-Ig, Clone: 1C10B4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

RDM1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66941-1-Ig

Clone No.1C10B4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

RAD52 homolog B, RAD52 motif 1, RAD52B, RDM1

---

Tested Applications

• Positive WB detected in: PC-3 cells, HEK-293 cells, HSC-T6 cells, RAW 264.7 cells
• Positive IHC detected in: human thyroid cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:150-1:600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66941-1-Ig targets RDM1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28686

  Product name: Recombinant human RDM1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-253 aa of BC038301

  Sequence: QHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSARAAHRAQKACDRKQLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANYCFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLVEEPMDKVEEGPLSFLMKRKTAQKLAIQKALSDAFQKLLIVVLESGKIAVEYRPSEDIVGVRCEEELHGLIQVPCSPWKQYGQEEEGYLSDFSLEEEEFRLPELD

• Full Name: RAD52 motif 1
• Calculated Molecular Weight: 284 aa, 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC038301
• Gene Symbol: RDM1
• Gene ID (NCBI): 201299
• RRID: AB_2882265
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8NG50
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RDM1, also named as RAD52B, encodes a RNA recognition motif (RRM)-containing protein confered resistance to the antitumor agent cisplatin. The expression of RDM1 is closely related to the cell proliferation and apoptosis of thyroid carcinoma cells and RDM1 may be a potential marker of lung adenocarcinoma. RDM1 has many isoforms (8 kDa, 12-19 kDa and 25-32 kDa) with long or short N-terminus and a great diversity in the exonic composition of C-terminus generated by alternative pre-mRNA splicing and differential usage of two translational start sites. RDM1 protein can be expressed differently in cytoplasm or nuclear/nucleolar in the absence of stress, proteotoxic stress and mild heat shock, suggesting functional differences among the RDM1 proteins. ( PMID: 28939762, 17905820, 28939762, 30069034)