Use Able AI chat for product recommendations

CoraLite®594-conjugated RDM1 Monoclonal antibody

RDM1 Monoclonal Antibody for IF/ICC

Cat No. CL594-66941
Clone No.1C10B4

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

IF/ICC

RAD52 homolog B, RAD52 motif 1, RAD52B, RDM1

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66941 targets RDM1 in IF/ICC applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28686

Product name: Recombinant human RDM1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-253 aa of BC038301

Sequence: QHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSARAAHRAQKACDRKQLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANYCFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLVEEPMDKVEEGPLSFLMKRKTAQKLAIQKALSDAFQKLLIVVLESGKIAVEYRPSEDIVGVRCEEELHGLIQVPCSPWKQYGQEEEGYLSDFSLEEEEFRLPELD

Predict reactive species
Full Name RAD52 motif 1
Calculated Molecular Weight 284 aa, 32 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC038301
Gene Symbol RDM1
Gene ID (NCBI) 201299
RRIDAB_2920061
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8NG50
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RDM1, also named as RAD52B, encodes a RNA recognition motif (RRM)-containing protein confered resistance to the antitumor agent cisplatin. The expression of RDM1 is closely related to the cell proliferation and apoptosis of thyroid carcinoma cells and RDM1 may be a potential marker of lung adenocarcinoma. RDM1 has many isoforms (8 kDa, 12-19 kDa and 25-32 kDa) with long or short N-terminus and a great diversity in the exonic composition of C-terminus generated by alternative pre-mRNA splicing and differential usage of two translational start sites. RDM1 protein can be expressed differently in cytoplasm or nuclear/nucleolar in the absence of stress, proteotoxic stress and mild heat shock, suggesting functional differences among the RDM1 proteins. ( PMID: 28939762, 17905820, 28939762, 30069034)

Protocols

Product Specific Protocols
IF protocol for CL594 RDM1 antibody CL594-66941Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...