REEP5 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• REEP5 Recombinant monoclonal antibody, PBS Only (86849-1-PBS)

• 

  WB analysis using 86849-1-RR (same clone as 86849-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86849-1-RR (REEP5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86849-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 86849-1-RR (same clone as 86849-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using REEP5 antibody (86849-1-RR, Clone: 251882F7 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86849-1-PBS in a different storage buffer formulation.

REEP5 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86849-1-PBS

Clone No.251882F7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

C5orf18, DP1, Polyposis locus protein 1, Protein TB2, Receptor expression-enhancing protein 5

---

Product Information

86849-1-PBS targets REEP5 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6229

  Product name: Recombinant human REEP5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-189 aa of BC065926

  Sequence: MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

• Full Name: receptor accessory protein 5
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC065926
• Gene Symbol: REEP5
• Gene ID (NCBI): 7905
• RRID: AB_3745161
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q00765
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

REEP5 (receptor expression-enhancing protein 5), also named as C5orf18, DP1 or TB2, is a membrane protein belonging to DP1/Yop1p protein family. All REEP proteins contain a conserved TB2/DP1, HVA22 domain which is involved in intracellular trafficking and secretion (PMID: 19123125). REEP5 is expressed in circumvallate papillae and testis, and may have the function to influence functional cell surface expression of taste receptors (PMID: 16720576). REEP5 can interact with atlastins (ATL1 and ATL2) which are involved in modulating the structure of ER network (PMID: 19665976).