REEP6 Polyclonal antibody

• 

  WB analysis of BxPC-3 using 12088-1-AP

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 12088-1-AP (REEP6 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 12088-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12088-1-AP (REEP6 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of BxPC-3 using 12088-1-AP

  IP result of anti-REEP6 (IP:12088-1-AP, 4ug; Detection:12088-1-AP 1:600) with BxPC-3 cells lysate 2080 ug.

• 

  IHC staining of human pancreas cancer using 12088-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 12088-1-AP (REEP6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 12088-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 12088-1-AP (REEP6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 12088-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using REEP6 antibody (12088-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of mouse olfactory epithelium tissue using 12088-1-AP

  Fluorescent IHC on 1%PLP fixed frozen mouse olfactory epithelium tissue of REEP6 antibody (12088-1-AP, 1:100). Excellent staining of Sus cells on the apical layer as well as their basal projections. By Dr. Brian Lin (Schwob Lab).

• Featured Product
• KD/KO Validated

REEP6 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12088-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Receptor expression-enhancing protein 6, Polyposis locus protein 1-like 1, DP1L1, C19orf32

---

Tested Applications

• Positive WB detected in: BxPC-3 cells, HepG2 cells, mouse liver tissue, rat liver tissue
• Positive IP detected in: BxPC-3 cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, mouse olfactory epithelium tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 1 publications below
• IF: See 2 publications below
• IP: See 1 publications below

Product Information

12088-1-AP targets REEP6 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2723

  Product name: Recombinant human REEP6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-184 aa of BC008201

  Sequence: MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYASIKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVKPSQTPQPKDK

• Full Name: receptor accessory protein 6
• Calculated Molecular Weight: 201 aa, 22 kDa
• Observed Molecular Weight: 17-22 kDa
• GenBank Accession Number: BC008201
• Gene Symbol: REEP6
• Gene ID (NCBI): 92840
• RRID: AB_2178460
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96HR9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IP	Mol Psychiatry; Dysfunctional tubular endoplasmic reticulum constitutes a pathological feature of Alzheimer's disease.; Authors - M G Sharoar
rat	WB	J Clin Invest; Nasal neuron PET imaging quantifies neuron generation and degeneration.; Authors - Genevieve C Van de Bittner
human	WB,IF	Am J Hum Genet; Mutations in REEP6 Cause Autosomal-Recessive Retinitis Pigmentosa.; Authors - Gavin Arno
mouse	IF	Hum Mol Genet; REEP6 deficiency leads to retinal degeneration through disruption of ER homeostasis and protein trafficking.; Authors - Smriti A Agrawal
human	WB,IHC	Int J Biol Macromol; Receptor accessory protein 6, a novel ferroptosis suppressor, drives oral squamous cell carcinoma by maintaining endoplasmic reticulum hemostasis; Authors - Lingyun Xia