REG Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84287-3-RR (same clone as 84287-3-PBS)

  mouse stomach tissue, mouse pancreas tissue, rat pancreas tissue, This data was developed using the same antibody clone with 84287-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 84287-3-RR (same clone as 84287-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 84287-3-RR (REG antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84287-3-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse pancreas using 84287-3-RR (same clone as 84287-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse pancreas tissue using REG antibody (84287-3-RR, Clone: 241617H2 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84287-3-PBS in a different storage buffer formulation.

REG Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 84287-3-PBS

Clone No.241617H2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

REG1 alpha, REG1A, 241617H2, ICRF, Lithostathine 1 alpha

---

Product Information

84287-3-PBS targets REG in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8640

  Product name: Recombinant human REG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-166 aa of BC005350

  Sequence: MAQTSSYFMLISCLMFLSQSQGQEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN

• Full Name: regenerating islet-derived 1 alpha
• Calculated Molecular Weight: 166 aa, 19 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC005350
• Gene Symbol: REG
• Gene ID (NCBI): 5967
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P05451
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. It's reported that REG1A was significantly upregulated in tumor specimens and adenoma as compared to normal colorectal tissue. (PMID: 34698109)