REG3G Polyclonal antibody

• Home
• Products
• Primary Antibodies
• REG3G Polyclonal antibody (33895-1-AP)

REG3G Polyclonal Antibody for WB, ELISA

Cat No. 33895-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Pancreatitis-associated protein 1B, Pancreatitis-associated protein IB, PAP IB, PAP1B, PAP-1B

• 

  WB analysis using 33895-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33895-1-AP (REG3G antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for REG3G in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse pancreas tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33895-1-AP targets REG3G in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35686

  Product name: Recombinant human REG3G protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-175 aa of BC103854

  Sequence: EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD

• Full Name: regenerating islet-derived 3 gamma
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC103854
• Gene Symbol: REG3G
• Gene ID (NCBI): 130120
• RRID: AB_3743105
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6UW15
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

REG3G (Regenerating Islet-Derived 3 Gamma) is a small intestinal C-type lectin-like antimicrobial peptide mainly secreted by Paneth cells. First identified in regenerating pancreas, it is now recognized as a key defender of the gut barrier: it kills Gram-positive bacteria, limits bacterial contact with the epithelium, and thus helps prevent systemic inflammation and metabolic disease. Beyond its antimicrobial role, REG3G acts as a gut-derived hormone that links the intestinal microbiome to host metabolism. Its expression is boosted by dietary fiber, beneficial bacteria, interleukin-22 (IL-22) and bariatric surgery, and it reciprocally improves glucose control, reduces hepatic steatosis, accelerates wound healing and protects pancreatic β-cells by activating the JAK2/STAT3 pathway . Conversely, chronic alcohol intake or dysbiosis lowers REG3G levels, weakening the gut barrier and promoting alcoholic liver disease.

Publications

What published studies show

The REG3G Polyclonal antibody (Cat# 33895-1-AP) has 1 total citation. It was cited in Current Research in Food Science (IF 7.7), a 2026 study investigating how high-sugar and carrageenan-containing diets impair the intestinal mucosal barrier via gut microbiota. The research field encompasses food science, gut microbiology, and intestinal barrier function. The antibody was applied in Western Blot using mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Curr Res Food Sci; High-sugar and carrageenan-containing diets synergistically impair the intestinal mucosal barrier through the gut microbiota: in vitro and in vivo studies.; Authors - Yuan Gao