REG3G Polyclonal antibody

• 

  WB analysis using 33895-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33895-1-AP (REG3G antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

REG3G Polyclonal Antibody for WB, ELISA

Cat No. 33895-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Pancreatitis-associated protein 1B, Pancreatitis-associated protein IB, PAP IB, PAP1B, PAP-1B

---

Tested Applications

• Positive WB detected in: mouse pancreas tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33895-1-AP targets REG3G in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35686

  Product name: Recombinant human REG3G protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-175 aa of BC103854

  Sequence: EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD

• Full Name: regenerating islet-derived 3 gamma
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC103854
• Gene Symbol: REG3G
• Gene ID (NCBI): 130120
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6UW15
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

REG3G (Regenerating Islet-Derived 3 Gamma) is a small intestinal C-type lectin-like antimicrobial peptide mainly secreted by Paneth cells. First identified in regenerating pancreas, it is now recognized as a key defender of the gut barrier: it kills Gram-positive bacteria, limits bacterial contact with the epithelium, and thus helps prevent systemic inflammation and metabolic disease. Beyond its antimicrobial role, REG3G acts as a gut-derived hormone that links the intestinal microbiome to host metabolism. Its expression is boosted by dietary fiber, beneficial bacteria, interleukin-22 (IL-22) and bariatric surgery, and it reciprocally improves glucose control, reduces hepatic steatosis, accelerates wound healing and protects pancreatic β-cells by activating the JAK2/STAT3 pathway . Conversely, chronic alcohol intake or dysbiosis lowers REG3G levels, weakening the gut barrier and promoting alcoholic liver disease.