REL Polyclonal antibody

• 

  WB analysis using 27693-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27693-1-AP (REL antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

REL Polyclonal Antibody for WB, ELISA

Cat No. 27693-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (2)

Applications

WB, ELISA

Synonyms

REL, C Rel, Proto oncogene c Rel

---

Tested Applications

• Positive WB detected in: Daudi cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

27693-1-AP targets REL in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26776

  Product name: Recombinant human REL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 279-471 aa of NM_001291746

  Sequence: MYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVG

• Full Name: v-rel reticuloendotheliosis viral oncogene homolog (avian)
• Calculated Molecular Weight: 69 kDa
• Observed Molecular Weight: 68-78 kDa
• GenBank Accession Number: NM_001291746
• Gene Symbol: REL
• Gene ID (NCBI): 5966
• RRID: AB_3669617
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q04864
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

REL, also known as, Proto-oncogene c-Rel, is a 619 amino acid protein, which may play a role in differentiation and lymphopoiesis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The NF-kappa-B heterodimer RELA/p65-c-Rel is a transcriptional activator.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Transl Cancer Res; Effects of antisense lncRNA PCBP1-AS1 on biological behaviors of vulvar squamous carcinoma cells by regulating TRAF5 and NF-κB expression; Authors - Hongyu Wang
human,mouse	WB	Toxicol Appl Pharmacol; Sappanone a ameliorates acute lung injury through inhibiting the activation of the NF-κB signaling pathway; Authors - Jing Du